Citrus Sinensis ID: 038696


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680---
MEQFGRIGEVMGSMKALMVFRDSIQINQRQCCLLLDIFSFAYDSIAEEMRQNLRFEERRAKWKILEQPLKELFRIFKEGENYIKQCLEIRDWWAKAITLYQNTDCVEFYIHNLLSCIPILIEAIETAAEFSGWDPDQMHKKKLVHSGKYKKEWKDHKLFQWRYGKQYLITPDFCYRIDTVWKEDRWILFNKIQQKKISGSTKQEQGLIDVLFKNLDGSGSLSGKLLPSRILIKSEDYQVRRRLGSGSQYKEILWLGESFALRHFFGDIEPLVPEISSLLSLSHPNIMHFLCGFTDEEKKECFLIMELMSRDLCSYIKEICCPRKRIPFSLPVAVDLMLQIARGMEYLHSKKIYHGNLNPSNILLKPRGASTEGYLHAKISGFGLSSVKNFGPKSPSQSGTTHPFIWHAPEVLEENEQTESASNSKYSEKSDVYSFGMICFEILTGKVPFEDAHLQGDKMSRNIRAGERPLFPFHSPKYVTNLTKRCWHADPNQRPSFSSICRILRYIKRFIMMNPHYNSQPDPPMPLVDYSDIESRLLRKFPSWETHNVLPISEIPFQMFVYRVVEKEKISSSPKDTSDSGSDKASVSGDENMTTPEDPSPPVTERKFLPSPEAVNKKLSGVKKLSESKVIKQTGTPKGRAVRPPQLIPCGRSLRMSSEGQLMAMSPRIQRTSSGHVSDSELS
cHHHHHHHHHHcccHHEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccHHccccCEEEcHHHHHccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccccccccEEEcccccEEEEECcccccEEEEEEcccccEEEECcccccHHHHHHHHHHccccccCEEEEEEECcccccEEEEEEEcccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***FGRIGEVMGSMKALMVFRDSIQINQRQCCLLLDIFSFAYDSIAEEMRQNLRFEERRAKWKILEQPLKELFRIFKEGENYIKQCLEIRDWWAKAITLYQNTDCVEFYIHNLLSCIPILIEAIETAAEFSGWDPDQMHKKKLVHSGKYKKEWKDHKLFQWRYGKQYLITPDFCYRIDTVWKEDRWILFNKIQQKKIS*****EQGLIDVLFKNLDGSGSLSGKLLPSRILIKSEDYQVRRRLGSGSQYKEILWLGESFALRHFFGDIEPLVPEISSLLSLSHPNIMHFLCGFTDEEKKECFLIMELMSRDLCSYIKEICCPRKRIPFSLPVAVDLMLQIARGMEYLHSKKIYHGNLNPSNILLKPRGASTEGYLHAKISGFGLSSVKN*********GTTHPFIWHAPEVLEENEQTE*****KYSEKSDVYSFGMICFEILTGKVPFEDAHLQGDKMSRNIRAGERPLFPFHSPKYVTNLTKRCWHADPNQRPSFSSICRILRYIKRFIMMNPHY*********LVDYSDIESRLLRKFPS**THNVLPISEIPFQMFVYR*VE*********************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQFGRIGEVMGSMKALMVFRDSIQINQRQCCLLLDIFSFAYDSIAEEMRQNLRFEERRAKWKILEQPLKELFRIFKEGENYIKQCLEIRDWWAKAITLYQNTDCVEFYIHNLLSCIPILIEAIETAAEFSGWDPDQMHKKKLVHSGKYKKEWKDHKLFQWRYGKQYLITPDFCYRIDTVWKEDRWILFNKIQQKKISGSTKQEQGLIDVLFKNLDGSGSLSGKLLPSRILIKSEDYQVRRRLGSGSQYKEILWLGESFALRHFFGDIEPLVPEISSLLSLSHPNIMHFLCGFTDEEKKECFLIMELMSRDLCSYIKEICCPRKRIPFSLPVAVDLMLQIARGMEYLHSKKIYHGNLNPSNILLKPRGASTEGYLHAKISGFGLSSVKNFGPKSPSQSGTTHPFIWHAPEVLEENEQTESASNSKYSEKSDVYSFGMICFEILTGKVPFEDAHLQGDKMSRNIRAGERPLFPFHSPKYVTNLTKRCWHADPNQRPSFSSICRILRYIKRFIMMNPHYNSQPDPPMPLVDYSDIESRLLRKFPSWETHNVLPISEIPFQMFVYRVVEKEKISSSPKDTSDSGSDKASVSGDENMTTPEDPSPPVTERKFLPSPEAVNKKLSGVKKLSESKVIKQTGTPKGRAVRPPQLIPCGRSLRMSSEGQLMAMSPRIQRTSSGHVSDSELS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OZO, chain A
Confidence level:very confident
Coverage over the Query: 122-389,403-511
View the alignment between query and template
View the model in PyMOL
Template: 2RIO, chain A
Confidence level:very confident
Coverage over the Query: 235-319,331-390,403-504
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:confident
Coverage over the Query: 235-531
View the alignment between query and template
View the model in PyMOL
Template: 3CXL, chain A
Confidence level:probable
Coverage over the Query: 91-261
View the alignment between query and template
View the model in PyMOL