Query         038706
Match_columns 127
No_of_seqs    121 out of 164
Neff          6.1 
Searched_HMMs 46136
Date          Fri Mar 29 02:32:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038706.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038706hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1311 DHHC-type Zn-finger pr  99.8 4.1E-19 8.8E-24  142.7   3.7  124    2-127     9-151 (299)
  2 PF01529 zf-DHHC:  DHHC palmito  99.3 3.7E-13   8E-18   99.3   1.9   68   59-127     2-86  (174)
  3 KOG1312 DHHC-type Zn-finger pr  99.2   7E-12 1.5E-16  101.6   4.9   94   28-127    85-186 (341)
  4 COG5273 Uncharacterized protei  99.2 3.5E-11 7.6E-16   98.3   5.6   68   56-127    68-147 (309)
  5 KOG1315 Predicted DHHC-type Zn  99.0 5.9E-11 1.3E-15   97.0   1.9  116    7-127    13-147 (307)
  6 KOG0509 Ankyrin repeat and DHH  98.7   2E-08 4.4E-13   87.9   6.9   36   91-127   417-458 (600)
  7 KOG1313 DHHC-type Zn-finger pr  98.1 4.3E-06 9.2E-11   67.8   5.2   33   94-127   102-140 (309)
  8 KOG1314 DHHC-type Zn-finger pr  98.0 6.6E-06 1.4E-10   68.7   4.1   65   54-127    58-129 (414)
  9 PF09125 COX2-transmemb:  Cytoc  62.7      11 0.00024   21.8   2.7   17   18-34     15-31  (38)
 10 PHA03029 hypothetical protein;  52.2      12 0.00026   25.2   1.9   32    2-36     47-78  (92)
 11 PF03839 Sec62:  Translocation   51.6      23  0.0005   28.1   3.8   28   12-39    105-133 (224)
 12 COG2839 Uncharacterized protei  48.3      43 0.00094   25.3   4.6   28   15-42      2-30  (160)
 13 PF05814 DUF843:  Baculovirus p  45.9      56  0.0012   22.1   4.4   52   20-72      3-55  (83)
 14 PF12955 DUF3844:  Domain of un  45.7      26 0.00056   24.6   2.9   22   13-34     67-88  (103)
 15 PF14798 Ca_hom_mod:  Calcium h  43.5      25 0.00054   28.2   2.9   19   14-32    178-196 (251)
 16 PF10939 DUF2631:  Protein of u  41.5      22 0.00048   23.0   1.9   26    6-31     23-49  (65)
 17 PF11085 YqhR:  Conserved membr  38.9      58  0.0012   25.0   4.1   24   15-38     70-93  (173)
 18 PRK14584 hmsS hemin storage sy  37.2 1.3E+02  0.0029   22.5   5.7   21   14-34     21-41  (153)
 19 PF07301 DUF1453:  Protein of u  35.9      95  0.0021   23.1   4.8   70    7-81     25-94  (148)
 20 smart00451 ZnF_U1 U1-like zinc  35.0      17 0.00038   19.3   0.6   12   94-105     3-14  (35)
 21 PF08552 Kei1:  Inositolphospho  34.4 1.4E+02   0.003   23.0   5.6   28   10-38     39-66  (189)
 22 PF10831 DUF2556:  Protein of u  33.1      64  0.0014   19.8   2.8    7    1-7       1-7   (53)
 23 PF06220 zf-U1:  U1 zinc finger  32.6      20 0.00044   20.4   0.6   11   95-105     4-14  (38)
 24 COG2832 Uncharacterized protei  32.5   1E+02  0.0022   22.3   4.2   25   14-41      6-30  (119)
 25 PF12874 zf-met:  Zinc-finger o  30.9      18 0.00039   17.8   0.1   11   96-106     2-12  (25)
 26 PHA02565 49 recombination endo  30.0      38 0.00081   25.6   1.8   26   91-119    17-43  (157)
 27 PF12270 Cyt_c_ox_IV:  Cytochro  29.8   2E+02  0.0043   21.2   5.5   56   18-73     10-70  (137)
 28 PF11947 DUF3464:  Protein of u  29.5      44 0.00095   25.0   2.1   31   46-76    102-132 (153)
 29 PF07010 Endomucin:  Endomucin;  29.0      68  0.0015   25.9   3.1   32   46-77    196-227 (259)
 30 PF12666 PrgI:  PrgI family pro  28.8 1.7E+02  0.0037   19.1   6.5   30   10-39     16-45  (93)
 31 PF11289 DUF3092:  Protein of u  28.5 1.4E+02  0.0031   23.9   4.8   43   33-75    102-146 (273)
 32 COG1585 Membrane protein impli  26.8 2.2E+02  0.0047   20.7   5.4   31   32-63     40-70  (140)
 33 PF12171 zf-C2H2_jaz:  Zinc-fin  26.8      41 0.00088   17.1   1.1   12   95-106     2-13  (27)
 34 PF11241 DUF3043:  Protein of u  26.7 2.2E+02  0.0048   21.7   5.5   18   16-33     77-94  (170)
 35 TIGR00383 corA magnesium Mg(2+  26.2 1.5E+02  0.0032   23.6   4.7   32   23-54    271-302 (318)
 36 COG0577 SalY ABC-type antimicr  25.8 1.4E+02   0.003   23.1   4.5   15   58-72    401-415 (419)
 37 PF04341 DUF485:  Protein of un  25.3      15 0.00032   24.7  -1.0    7   67-73     81-87  (91)
 38 PF13240 zinc_ribbon_2:  zinc-r  25.1      45 0.00097   16.9   1.0   16   96-111     1-16  (23)
 39 PRK13476 cytochrome b6-f compl  24.8      91   0.002   23.5   3.1   10   65-74     61-70  (160)
 40 TIGR00869 sec62 protein transl  24.7 1.8E+02  0.0038   23.3   4.8   27   14-40    115-142 (232)
 41 TIGR01156 cytb6/f_IV cytochrom  24.6   1E+02  0.0022   23.2   3.3   12   64-75     60-71  (159)
 42 PF13126 DUF3975:  Protein of u  24.4 2.2E+02  0.0048   18.9   5.2   14   13-26      6-19  (85)
 43 PF14143 YrhC:  YrhC-like prote  23.4 2.2E+02  0.0049   18.6   4.8   20   18-37     14-33  (72)
 44 PF04772 Flu_B_M2:  Influenza B  23.3 1.3E+02  0.0028   20.7   3.3   19   11-29      2-20  (109)
 45 PRK10845 colicin V production   22.6 2.2E+02  0.0048   20.9   4.8   24   15-38     30-53  (162)
 46 PRK11715 inner membrane protei  22.4 1.3E+02  0.0029   26.1   4.0   51    8-62    326-376 (436)
 47 PRK09546 zntB zinc transporter  22.1 1.4E+02  0.0031   24.0   4.0   16   24-39    278-293 (324)
 48 PF06123 CreD:  Inner membrane   21.7 1.5E+02  0.0032   25.8   4.1   50    9-62    321-370 (430)
 49 KOG2927 Membrane component of   21.7      46   0.001   28.3   1.0   24   17-40    189-213 (372)
 50 PF07535 zf-DBF:  DBF zinc fing  21.5      20 0.00044   21.8  -0.8   17   94-110     5-21  (49)
 51 PRK10527 hypothetical protein;  21.5 1.8E+02   0.004   20.8   4.0   19   23-41     12-30  (125)
 52 KOG2612 Predicted integral mem  20.5      57  0.0012   22.6   1.1   48   59-106    37-86  (103)
 53 PF04120 Iron_permease:  Low af  20.2 2.6E+02  0.0057   20.3   4.7   29   25-53     23-52  (132)

No 1  
>KOG1311 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=99.75  E-value=4.1e-19  Score=142.70  Aligned_cols=124  Identities=24%  Similarity=0.317  Sum_probs=80.0

Q ss_pred             CcccCCCCCCChhHHHHHHHHHHHHHHH--HhhhhcccChhhHHHHHHHHHHHHHHHHHhhheeeeeecC-CCCCCccCC
Q 038706            2 ARRHGWQLPAHTFQVVAITVFFLLSVAY--YAFFAPFLGTELYEYVAIGVYSVLAFCVFILYVRCTGIDP-ADPGILIEP   78 (127)
Q Consensus         2 ~R~nGw~~Plh~~Qv~~W~~~~~l~~~~--f~~~iP~l~~~~~~~~~~~v~~~l~~~~~~~~~~~t~iDP-aD~~v~~~~   78 (127)
                      .|+.||.....+..+..++.+++.....  +++..+.++. .+....+.+.++++....++....+...+ +||++..+.
T Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~-~~~~~~~~~~~~if~~~~~~~~~~~~~~~~sdpg~~p~~   87 (299)
T KOG1311|consen    9 IPRRGGRILDPPVALPVLVTYVLLVGSETFFVFLPPLLPR-GGVSPAVLVLGAIFFLLNILNLMLACFRMLSDPGIVPRA   87 (299)
T ss_pred             ccCCCceeeccccchhHHHHHHHHhhheEEEEEEeeecCC-cccchHHHHHHHHHHHHHHHHHHHHHhcccCCCceecCc
Confidence            4677888888888888888877777666  5555566664 12222233333333332222222222222 666655432


Q ss_pred             -Cc---------cccccccCCCCCCCCccccccccccCCCCcc------cCCCCCCCceeccCCC
Q 038706           79 -DK---------ISAYKLQNDTDLPGKYSDNSQIRVLSAESGR------IHRFDGIKHTWLLNVI  127 (127)
Q Consensus        79 -~~---------~~~drsk~~hvi~n~~C~lC~i~V~~~tKHC------v~~FDh~hc~WlnNci  127 (127)
                       +.         ...+..+++++++..||+.|+..+-+|||||      |.|||| ||+|+||||
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~rPpRs~HCsvC~~CV~rfDH-HC~WvnnCV  151 (299)
T KOG1311|consen   88 DDEQIEDPERAPLYKNVDVNGIQVEWKYCDTCQLYRPPRSSHCSVCNNCVLRFDH-HCPWLNNCI  151 (299)
T ss_pred             ccCCCCCccccccCCCcccCCcccceEEcCcCcccCCCCcccchhhcccccccCC-CCCCccceE
Confidence             11         1233445777888899999999999999997      899999 899999998


No 2  
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=99.33  E-value=3.7e-13  Score=99.28  Aligned_cols=68  Identities=24%  Similarity=0.196  Sum_probs=49.2

Q ss_pred             hhheeeeeecCCCCCCccC-C------C----ccccccccCCCCCCCCccccccccccCCCCcc------cCCCCCCCce
Q 038706           59 ILYVRCTGIDPADPGILIE-P------D----KISAYKLQNDTDLPGKYSDNSQIRVLSAESGR------IHRFDGIKHT  121 (127)
Q Consensus        59 ~~~~~~t~iDPaD~~v~~~-~------~----~~~~drsk~~hvi~n~~C~lC~i~V~~~tKHC------v~~FDh~hc~  121 (127)
                      ++++++..+||........ .      .    ....+....+...+..+|..|++.--.|||||      |.+||| ||-
T Consensus         2 ~~~~~~~~~dPG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~DH-HC~   80 (174)
T PF01529_consen    2 WSYFLTIFIDPGYVPRSNPDEDQRQEEKEEEQNQSIDSPEDDENGELKYCSTCKIIKPPRSHHCRVCNRCVLRFDH-HCP   80 (174)
T ss_pred             EEehhhheECCcccCCccccccccccccccccchhhhhhccccCCCCEECcccCCcCCCcceeccccccccccccc-cch
Confidence            4577888999988776610 0      0    00122223344455678999999989999998      799999 899


Q ss_pred             eccCCC
Q 038706          122 WLLNVI  127 (127)
Q Consensus       122 WlnNci  127 (127)
                      |+||||
T Consensus        81 w~~~cI   86 (174)
T PF01529_consen   81 WLGNCI   86 (174)
T ss_pred             hhcccc
Confidence            999998


No 3  
>KOG1312 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=99.25  E-value=7e-12  Score=101.56  Aligned_cols=94  Identities=19%  Similarity=0.183  Sum_probs=55.5

Q ss_pred             HHHhhhhcccChhhHHHHHHHHHHHHHHHHHhhheeeeeecCCCCCCccCCCccccccccCCCCC--CCCcccccccccc
Q 038706           28 AYYAFFAPFLGTELYEYVAIGVYSVLAFCVFILYVRCTGIDPADPGILIEPDKISAYKLQNDTDL--PGKYSDNSQIRVL  105 (127)
Q Consensus        28 ~~f~~~iP~l~~~~~~~~~~~v~~~l~~~~~~~~~~~t~iDPaD~~v~~~~~~~~~drsk~~hvi--~n~~C~lC~i~V~  105 (127)
                      ..+.+..|.++.+....  +.++.. +++-.++...+...||+..+-..+....  .+-.-|.+|  +|..|.-|+++=-
T Consensus        85 ~esfiy~~~l~lsl~~~--il~~l~-vivp~i~f~ltc~snpg~i~k~n~s~~~--~~ypYDy~if~k~~kCSTCki~KP  159 (341)
T KOG1312|consen   85 WESFIYCQELELSLHYL--ILPYLL-VIVPLIFFTLTCGSNPGIITKANESLFL--HVYPYDYVIFPKNVKCSTCKIRKP  159 (341)
T ss_pred             heeeEeccchhhhHHHH--HHHHHH-HHHHHHHHhhhhcCCCCccchhhhccce--eccCccceeecCCCccccccCCCc
Confidence            44556667665532222  222222 2222333444556777766533222111  111233333  4668999999888


Q ss_pred             CCCCcc------cCCCCCCCceeccCCC
Q 038706          106 SAESGR------IHRFDGIKHTWLLNVI  127 (127)
Q Consensus       106 ~~tKHC------v~~FDh~hc~WlnNci  127 (127)
                      +|||||      |.|||| ||.|.||||
T Consensus       160 ARSKHCsiCNrCV~rfDH-HCiWiNNCI  186 (341)
T KOG1312|consen  160 ARSKHCSICNRCVHRFDH-HCIWINNCI  186 (341)
T ss_pred             cccccchHHHHHHHHhcc-ceEeeeccc
Confidence            999998      799999 899999998


No 4  
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only]
Probab=99.17  E-value=3.5e-11  Score=98.30  Aligned_cols=68  Identities=15%  Similarity=0.153  Sum_probs=47.6

Q ss_pred             HHHhhheeeeeecCCCCC--CccCCC----ccccccccCCCCCCCCccccccccccCCCCcc------cCCCCCCCceec
Q 038706           56 CVFILYVRCTGIDPADPG--ILIEPD----KISAYKLQNDTDLPGKYSDNSQIRVLSAESGR------IHRFDGIKHTWL  123 (127)
Q Consensus        56 ~~~~~~~~~t~iDPaD~~--v~~~~~----~~~~drsk~~hvi~n~~C~lC~i~V~~~tKHC------v~~FDh~hc~Wl  123 (127)
                      ....+++.....||.-+.  .-..+.    ++..+   .++..+..+|.-|+..--+|||||      |.+||| ||-|+
T Consensus        68 ~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~C~~C~~~KP~RS~HC~~Cn~CV~k~DH-HC~Wi  143 (309)
T COG5273          68 LASFSYLLLLVSDPGYLGENITLSGYRETISRLLD---DGKFGTENFCSTCNIYKPPRSHHCSICNRCVLKFDH-HCPWI  143 (309)
T ss_pred             hHHHhhHHHhhcCCCccCccccccchhhhhhhhhh---cCccccceeccccccccCCCCccchhhcchhhccCc-cCccc
Confidence            455677777777887664  111111    11222   233444569999999999999998      799999 89999


Q ss_pred             cCCC
Q 038706          124 LNVI  127 (127)
Q Consensus       124 nNci  127 (127)
                      ||||
T Consensus       144 ~nCV  147 (309)
T COG5273         144 NNCV  147 (309)
T ss_pred             cccc
Confidence            9998


No 5  
>KOG1315 consensus Predicted DHHC-type Zn-finger protein [General function prediction only]
Probab=99.05  E-value=5.9e-11  Score=97.02  Aligned_cols=116  Identities=16%  Similarity=0.236  Sum_probs=83.5

Q ss_pred             CCCCCChhHHHHHHHHHHHHHHHHhhhhcccChhhHHHHHHHHHHHHHHHHHhhheeeeeecCCCCCCccCCCccccccc
Q 038706            7 WQLPAHTFQVVAITVFFLLSVAYYAFFAPFLGTELYEYVAIGVYSVLAFCVFILYVRCTGIDPADPGILIEPDKISAYKL   86 (127)
Q Consensus         7 w~~Plh~~Qv~~W~~~~~l~~~~f~~~iP~l~~~~~~~~~~~v~~~l~~~~~~~~~~~t~iDPaD~~v~~~~~~~~~drs   86 (127)
                      |..|+...++++|.++++.+.    +.++.+..+.+..+...+++.++++..+.+.++..+||.-+......+.+..++.
T Consensus        13 ~~~~~~i~~~~~~~yy~~v~~----~c~~~i~~~~~~~~~ll~~~~ll~m~~~sy~~~vf~~pg~vp~~~~~~~~~~~~~   88 (307)
T KOG1315|consen   13 WIPVLIILLVIGWTYYVYVAV----LCILSISLTIPSVLLLLLFHLLLIMFLWSYFRTVFTDPGRVPDSYRPSVEDEDSL   88 (307)
T ss_pred             chhheeeeeeEEEEEEEeehh----hhHHHHhhhhHHHHHHHHHHHHHHHHHHHHHheeEecCCCCccccCCCcCccccc
Confidence            778888888888888765442    2334444333455556677777788889999999999998877765544433332


Q ss_pred             cCCCC-------------CCCCccccccccccCCCCcc------cCCCCCCCceeccCCC
Q 038706           87 QNDTD-------------LPGKYSDNSQIRVLSAESGR------IHRFDGIKHTWLLNVI  127 (127)
Q Consensus        87 k~~hv-------------i~n~~C~lC~i~V~~~tKHC------v~~FDh~hc~WlnNci  127 (127)
                      ++..+             -+-.+|+-|+.-.-+||-||      |-++|| ||-|.|||+
T Consensus        89 ~~~~~~~~~~~~~~~~~~g~~R~C~kC~~iKPdRaHHCsvC~rCvLKmDH-HCpWi~nCV  147 (307)
T KOG1315|consen   89 ENGSDNERDLPGYTRTSDGAVRYCDKCKCIKPDRAHHCSVCNRCVLKMDH-HCPWINNCV  147 (307)
T ss_pred             cccCcccccceeeEecCCCCceeecccccccCCccccchhhhhhhhcccc-CCcceecee
Confidence            22222             24468999999888999998      688999 899999996


No 6  
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only]
Probab=98.75  E-value=2e-08  Score=87.86  Aligned_cols=36  Identities=25%  Similarity=0.431  Sum_probs=32.4

Q ss_pred             CCCCCccccccccccCCCCcc------cCCCCCCCceeccCCC
Q 038706           91 DLPGKYSDNSQIRVLSAESGR------IHRFDGIKHTWLLNVI  127 (127)
Q Consensus        91 vi~n~~C~lC~i~V~~~tKHC------v~~FDh~hc~WlnNci  127 (127)
                      +.||.||.-|-++.-.+||||      |+|||| ||=|.+|||
T Consensus       417 ~~en~FC~~clirKp~rSkhc~vcnrcVarfDH-hCPwi~ncV  458 (600)
T KOG0509|consen  417 DLENRFCLTCLIRKPLRSKHCSVCNRCVARFDH-HCPWIGNCV  458 (600)
T ss_pred             cccccceeeeeeecCCccchhhhhHHHHhcccc-CCCcccccc
Confidence            345579999999999999998      799999 899999997


No 7  
>KOG1313 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=98.12  E-value=4.3e-06  Score=67.81  Aligned_cols=33  Identities=9%  Similarity=0.292  Sum_probs=30.3

Q ss_pred             CCccccccccccCCCCcc------cCCCCCCCceeccCCC
Q 038706           94 GKYSDNSQIRVLSAESGR------IHRFDGIKHTWLLNVI  127 (127)
Q Consensus        94 n~~C~lC~i~V~~~tKHC------v~~FDh~hc~WlnNci  127 (127)
                      +++|.-|.-.=+++|-||      |-+-|| ||-|+|||.
T Consensus       102 ~SfC~KC~~pK~prTHHCsiC~kCVL~MDH-HCPwinnCV  140 (309)
T KOG1313|consen  102 DSFCNKCNYPKSPRTHHCSICNKCVLKMDH-HCPWINNCV  140 (309)
T ss_pred             ccHHhhcCCCCCCCcchhhHHhhHhhcccc-CCchhhccc
Confidence            579999999999999998      788999 899999995


No 8  
>KOG1314 consensus DHHC-type Zn-finger protein [General function prediction only]
Probab=97.99  E-value=6.6e-06  Score=68.69  Aligned_cols=65  Identities=12%  Similarity=0.186  Sum_probs=49.2

Q ss_pred             HHHHHhhheeeeeecCCCCCCccCCCccccccccCCCC-CCCCccccccccccCCCCcc------cCCCCCCCceeccCC
Q 038706           54 AFCVFILYVRCTGIDPADPGILIEPDKISAYKLQNDTD-LPGKYSDNSQIRVLSAESGR------IHRFDGIKHTWLLNV  126 (127)
Q Consensus        54 ~~~~~~~~~~~t~iDPaD~~v~~~~~~~~~drsk~~hv-i~n~~C~lC~i~V~~~tKHC------v~~FDh~hc~WlnNc  126 (127)
                      ..++.+-++.|+...|.-+-.-.++..        ..| +.-+||.-||-.=-++|-||      |-.-|| ||-|.|||
T Consensus        58 ~~m~~~ny~~A~~~gPG~vp~~wkPe~--------~~D~~~lqfCk~CqgYKapRSHHCrkCnrCvmkMDH-HCPWinnC  128 (414)
T KOG1314|consen   58 TSMILYNYFNAIFTGPGFVPLGWKPEN--------PKDEMFLQFCKKCQGYKAPRSHHCRKCNRCVMKMDH-HCPWINNC  128 (414)
T ss_pred             HHHHHHHHHHHHhcCCCCCCCCCCCCC--------ChhHHHHHHHhhccCcCCCccccchHHHHHHHhhcc-CCcchhhc
Confidence            344667889999999987765443322        222 33469999999888999998      677999 89999999


Q ss_pred             C
Q 038706          127 I  127 (127)
Q Consensus       127 i  127 (127)
                      .
T Consensus       129 V  129 (414)
T KOG1314|consen  129 V  129 (414)
T ss_pred             c
Confidence            5


No 9  
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=62.69  E-value=11  Score=21.82  Aligned_cols=17  Identities=12%  Similarity=0.165  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHhhhh
Q 038706           18 AITVFFLLSVAYYAFFA   34 (127)
Q Consensus        18 ~W~~~~~l~~~~f~~~i   34 (127)
                      +|++|.+..+..|+.++
T Consensus        15 ~Wi~F~l~mi~vFi~li   31 (38)
T PF09125_consen   15 GWIAFALAMILVFIALI   31 (38)
T ss_dssp             HHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHH
Confidence            68888877777666654


No 10 
>PHA03029 hypothetical protein; Provisional
Probab=52.18  E-value=12  Score=25.21  Aligned_cols=32  Identities=28%  Similarity=0.357  Sum_probs=24.3

Q ss_pred             CcccCCCCCCChhHHHHHHHHHHHHHHHHhhhhcc
Q 038706            2 ARRHGWQLPAHTFQVVAITVFFLLSVAYYAFFAPF   36 (127)
Q Consensus         2 ~R~nGw~~Plh~~Qv~~W~~~~~l~~~~f~~~iP~   36 (127)
                      +||.||-|=+   ..+-|++=+.++.++|.|-+=+
T Consensus        47 srrkg~ywfl---nf~fwllp~al~a~fyffsiw~   78 (92)
T PHA03029         47 SRRKGLYWFL---NFLFWLLPFALAAAFYFFSIWF   78 (92)
T ss_pred             HHhhhHHHHH---HHHHHHHHHHHHHHHHHHHhhh
Confidence            4888888754   4567888888888888876643


No 11 
>PF03839 Sec62:  Translocation protein Sec62;  InterPro: IPR004728 Members of the NSCC2 family have been sequenced from various yeast, fungal and animals species including Saccharomyces cerevisiae, Drosophila melanogaster and Homo sapiens. These proteins are the Sec62 proteins, believed to be associated with the Sec61 and Sec63 constituents of the general protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins have been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane
Probab=51.61  E-value=23  Score=28.05  Aligned_cols=28  Identities=11%  Similarity=0.093  Sum_probs=18.1

Q ss_pred             ChhHHHHHHH-HHHHHHHHHhhhhcccCh
Q 038706           12 HTFQVVAITV-FFLLSVAYYAFFAPFLGT   39 (127)
Q Consensus        12 h~~Qv~~W~~-~~~l~~~~f~~~iP~l~~   39 (127)
                      .|-|...|+. +++++.+.-+.+.|+-|.
T Consensus       105 e~~~~~~~l~~~~~~~~v~a~~lFPlWP~  133 (224)
T PF03839_consen  105 EPSPLMQYLIGALLLVGVIAICLFPLWPR  133 (224)
T ss_pred             cCCcHHHHHHHHHHHHHHHHHHhhhcChH
Confidence            4556666766 444455556777898886


No 12 
>COG2839 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.27  E-value=43  Score=25.26  Aligned_cols=28  Identities=14%  Similarity=0.301  Sum_probs=22.2

Q ss_pred             HHHHHHHH-HHHHHHHHhhhhcccChhhH
Q 038706           15 QVVAITVF-FLLSVAYYAFFAPFLGTELY   42 (127)
Q Consensus        15 Qv~~W~~~-~~l~~~~f~~~iP~l~~~~~   42 (127)
                      |++-|+++ .++.+.+-+.+.|.+|....
T Consensus         2 ~~l~wlli~al~lvg~vGlv~PaiPs~ll   30 (160)
T COG2839           2 TILLWLLILALFLVGFVGLVYPAIPSTLL   30 (160)
T ss_pred             ccHHHHHHHHHHHHHHHhhhhcccchHHH
Confidence            67889988 66778888899999997443


No 13 
>PF05814 DUF843:  Baculovirus protein of unknown function (DUF843);  InterPro: IPR008561 This family consists of several unidentified baculovirus proteins of around 85 residues long with no known function.
Probab=45.92  E-value=56  Score=22.12  Aligned_cols=52  Identities=21%  Similarity=0.271  Sum_probs=24.0

Q ss_pred             HHHHHHHHHHHhhhhcccChhhHHHHHHH-HHHHHHHHHHhhheeeeeecCCCC
Q 038706           20 TVFFLLSVAYYAFFAPFLGTELYEYVAIG-VYSVLAFCVFILYVRCTGIDPADP   72 (127)
Q Consensus        20 ~~~~~l~~~~f~~~iP~l~~~~~~~~~~~-v~~~l~~~~~~~~~~~t~iDPaD~   72 (127)
                      +.+.+++.+.++|+.-=-.. .-+.+.+. +..+++++++-.++.=+..+|+|-
T Consensus         3 i~~~~~~Li~~~fi~~k~~~-~s~li~~~LilfviF~~~L~~yy~kteS~~~dL   55 (83)
T PF05814_consen    3 IYSLFLALIVLGFIFDKNEG-FSELIITLLILFVIFFCVLQVYYIKTESTPQDL   55 (83)
T ss_pred             HHHHHHHHHHHHHHHccccc-hHHHHHHHHHHHHHHHHHHHHHHcCCCCcHHHH
Confidence            34445555566665543321 12233332 233444445544555566666663


No 14 
>PF12955 DUF3844:  Domain of unknown function (DUF3844);  InterPro: IPR024382 This presumed domain is found in fungal species. It contains 8 largely conserved cysteine residues. This domain is found in proteins thought to be located in the endoplasmic reticulum.
Probab=45.67  E-value=26  Score=24.63  Aligned_cols=22  Identities=18%  Similarity=-0.025  Sum_probs=17.2

Q ss_pred             hhHHHHHHHHHHHHHHHHhhhh
Q 038706           13 TFQVVAITVFFLLSVAYYAFFA   34 (127)
Q Consensus        13 ~~Qv~~W~~~~~l~~~~f~~~i   34 (127)
                      ||++++|+..++++++.+++-.
T Consensus        67 ~F~L~~~~ti~lv~~~~~~I~l   88 (103)
T PF12955_consen   67 PFWLFAGFTIALVVLVAGAIGL   88 (103)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHH
Confidence            7889999998888777776543


No 15 
>PF14798 Ca_hom_mod:  Calcium homeostasis modulator
Probab=43.47  E-value=25  Score=28.23  Aligned_cols=19  Identities=16%  Similarity=0.202  Sum_probs=13.9

Q ss_pred             hHHHHHHHHHHHHHHHHhh
Q 038706           14 FQVVAITVFFLLSVAYYAF   32 (127)
Q Consensus        14 ~Qv~~W~~~~~l~~~~f~~   32 (127)
                      -|+++|++.++.+++.++.
T Consensus       178 SQ~lGW~LI~~~~i~a~l~  196 (251)
T PF14798_consen  178 SQVLGWILIALVIILAFLV  196 (251)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3899999888776666553


No 16 
>PF10939 DUF2631:  Protein of unknown function (DUF2631)   ;  InterPro: IPR024341 This entry represents a bacterial protein of unknown function.
Probab=41.52  E-value=22  Score=23.00  Aligned_cols=26  Identities=15%  Similarity=0.404  Sum_probs=19.4

Q ss_pred             CCC-CCCChhHHHHHHHHHHHHHHHHh
Q 038706            6 GWQ-LPAHTFQVVAITVFFLLSVAYYA   31 (127)
Q Consensus         6 Gw~-~Plh~~Qv~~W~~~~~l~~~~f~   31 (127)
                      ||+ -+....|+.+|+..++|..+.++
T Consensus        23 GWhg~~~r~~~i~g~~~~~~Ll~ml~G   49 (65)
T PF10939_consen   23 GWHGENPRAFRIAGWISALFLLAMLIG   49 (65)
T ss_pred             cccCCCCceeeehHHHHHHHHHHHHhc
Confidence            555 46778999999998877766554


No 17 
>PF11085 YqhR:  Conserved membrane protein YqhR;  InterPro: IPR024563 This family of proteins is conserved in the Bacillaceae family of the Firmicutes. Their function is not known.
Probab=38.94  E-value=58  Score=24.96  Aligned_cols=24  Identities=13%  Similarity=0.275  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHhhhhcccC
Q 038706           15 QVVAITVFFLLSVAYYAFFAPFLG   38 (127)
Q Consensus        15 Qv~~W~~~~~l~~~~f~~~iP~l~   38 (127)
                      |+++|+++.+++++.-.+.--++.
T Consensus        70 ~~igi~~~gv~Si~aAllY~~~l~   93 (173)
T PF11085_consen   70 NLIGIVFIGVFSIVAALLYYALLK   93 (173)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            778888888877665555444443


No 18 
>PRK14584 hmsS hemin storage system protein; Provisional
Probab=37.19  E-value=1.3e+02  Score=22.52  Aligned_cols=21  Identities=19%  Similarity=0.104  Sum_probs=14.4

Q ss_pred             hHHHHHHHHHHHHHHHHhhhh
Q 038706           14 FQVVAITVFFLLSVAYYAFFA   34 (127)
Q Consensus        14 ~Qv~~W~~~~~l~~~~f~~~i   34 (127)
                      +-+++|+.|+++.+.++.-.+
T Consensus        21 lT~~aW~gfi~l~~~~~~~~~   41 (153)
T PRK14584         21 LTALAWFGFLFLLVRGLLEMI   41 (153)
T ss_pred             HHHHHHHHHHHHHHHHHHHHh
Confidence            346899998887766665433


No 19 
>PF07301 DUF1453:  Protein of unknown function (DUF1453);  InterPro: IPR009916 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown. Members of this family seem to be found exclusively in the Order Bacillales.
Probab=35.90  E-value=95  Score=23.11  Aligned_cols=70  Identities=16%  Similarity=0.266  Sum_probs=41.2

Q ss_pred             CCCCCChhHHHHHHHHHHHHHHHHhhhhcccChhhHHHHHHHHHHHHHHHHHhhheeeeeecCCCCCCccCCCcc
Q 038706            7 WQLPAHTFQVVAITVFFLLSVAYYAFFAPFLGTELYEYVAIGVYSVLAFCVFILYVRCTGIDPADPGILIEPDKI   81 (127)
Q Consensus         7 w~~Plh~~Qv~~W~~~~~l~~~~f~~~iP~l~~~~~~~~~~~v~~~l~~~~~~~~~~~t~iDPaD~~v~~~~~~~   81 (127)
                      .+.|.++.-++-=.+  +++.+...+..|.....+++.+...+.|.+ ++.......--.++  |..+..|+++.
T Consensus        25 ~~rP~~~kkIIlPpl--fmstG~lmf~~P~~~~~~~~~l~A~~~G~l-Fs~~Li~ts~fEvr--d~~Iy~krSka   94 (148)
T PF07301_consen   25 SKRPVNGKKIILPPL--FMSTGFLMFVFPFFRPPWLEVLEAFLVGAL-FSYPLIKTSKFEVR--DGQIYLKRSKA   94 (148)
T ss_pred             ccCCCCcchHHHhHH--HHHHHHHHHhCccccchHHHHHHHHHHHHH-HHHHHHHhceEEEE--CCeEEEecccc
Confidence            456665555433332  266777778899977766777666666665 44433333333344  77777665543


No 20 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=35.05  E-value=17  Score=19.28  Aligned_cols=12  Identities=17%  Similarity=0.312  Sum_probs=10.0

Q ss_pred             CCcccccccccc
Q 038706           94 GKYSDNSQIRVL  105 (127)
Q Consensus        94 n~~C~lC~i~V~  105 (127)
                      +.+|.+|+..+.
T Consensus         3 ~~~C~~C~~~~~   14 (35)
T smart00451        3 GFYCKLCNVTFT   14 (35)
T ss_pred             CeEccccCCccC
Confidence            468999999776


No 21 
>PF08552 Kei1:  Inositolphosphorylceramide synthase subunit Kei1;  InterPro: IPR013862  This entry indicates Golgi proteins of unknown function. 
Probab=34.44  E-value=1.4e+02  Score=22.99  Aligned_cols=28  Identities=18%  Similarity=0.393  Sum_probs=18.7

Q ss_pred             CCChhHHHHHHHHHHHHHHHHhhhhcccC
Q 038706           10 PAHTFQVVAITVFFLLSVAYYAFFAPFLG   38 (127)
Q Consensus        10 Plh~~Qv~~W~~~~~l~~~~f~~~iP~l~   38 (127)
                      |+++.|+..-+ +.++++..|+...|-+.
T Consensus        39 ~ls~~Q~s~Yl-ySi~~L~~~~~~l~~Ir   66 (189)
T PF08552_consen   39 PLSFLQLSMYL-YSILALVLFAWGLPHIR   66 (189)
T ss_pred             CCCHHHHHHHH-HHHHHHHHHHHHhHHhc
Confidence            78899976544 34466667777776553


No 22 
>PF10831 DUF2556:  Protein of unknown function (DUF2556);  InterPro: IPR022540  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=33.09  E-value=64  Score=19.78  Aligned_cols=7  Identities=43%  Similarity=0.899  Sum_probs=3.5

Q ss_pred             CCcccCC
Q 038706            1 MARRHGW    7 (127)
Q Consensus         1 ~~R~nGw    7 (127)
                      |.||-||
T Consensus         1 mirky~w    7 (53)
T PF10831_consen    1 MIRKYWW    7 (53)
T ss_pred             Ccceehh
Confidence            4455554


No 23 
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=32.55  E-value=20  Score=20.42  Aligned_cols=11  Identities=18%  Similarity=0.223  Sum_probs=5.2

Q ss_pred             Ccccccccccc
Q 038706           95 KYSDNSQIRVL  105 (127)
Q Consensus        95 ~~C~lC~i~V~  105 (127)
                      .||+.|++.+.
T Consensus         4 yyCdyC~~~~~   14 (38)
T PF06220_consen    4 YYCDYCKKYLT   14 (38)
T ss_dssp             -B-TTT--B-S
T ss_pred             eecccccceec
Confidence            58999999984


No 24 
>COG2832 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.53  E-value=1e+02  Score=22.29  Aligned_cols=25  Identities=20%  Similarity=0.422  Sum_probs=18.2

Q ss_pred             hHHHHHHHHHHHHHHHHhhhhcccChhh
Q 038706           14 FQVVAITVFFLLSVAYYAFFAPFLGTEL   41 (127)
Q Consensus        14 ~Qv~~W~~~~~l~~~~f~~~iP~l~~~~   41 (127)
                      +++++|+   .++.+.-|++.|.||..+
T Consensus         6 ~i~iGfl---~l~LGIiGifLPlLPTTP   30 (119)
T COG2832           6 YIILGFL---SLALGIIGIFLPLLPTTP   30 (119)
T ss_pred             HHHHHHH---HHHHHHHHhcCcccCCcH
Confidence            4555554   467788899999999854


No 25 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=30.87  E-value=18  Score=17.83  Aligned_cols=11  Identities=27%  Similarity=0.259  Sum_probs=8.6

Q ss_pred             ccccccccccC
Q 038706           96 YSDNSQIRVLS  106 (127)
Q Consensus        96 ~C~lC~i~V~~  106 (127)
                      +|.+|+....+
T Consensus         2 ~C~~C~~~f~s   12 (25)
T PF12874_consen    2 YCDICNKSFSS   12 (25)
T ss_dssp             EETTTTEEESS
T ss_pred             CCCCCCCCcCC
Confidence            69999987654


No 26 
>PHA02565 49 recombination endonuclease VII; Provisional
Probab=29.97  E-value=38  Score=25.58  Aligned_cols=26  Identities=4%  Similarity=-0.023  Sum_probs=17.3

Q ss_pred             CCCCCccccccccccCC-CCcccCCCCCCC
Q 038706           91 DLPGKYSDNSQIRVLSA-ESGRIHRFDGIK  119 (127)
Q Consensus        91 vi~n~~C~lC~i~V~~~-tKHCv~~FDh~h  119 (127)
                      +.|++.|.+|+....+. .+-++   ||.|
T Consensus        17 e~Q~G~CaiC~~~l~~~~~~~~v---DHDH   43 (157)
T PHA02565         17 EAQNGICPLCKRELDGDVSKNHL---DHDH   43 (157)
T ss_pred             HHhCCcCCCCCCccCCCcccccc---CCCC
Confidence            35788999999876643 33333   7754


No 27 
>PF12270 Cyt_c_ox_IV:  Cytochrome c oxidase subunit IV;  InterPro: IPR021050  This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. This family is the fourth subunit of the cytochrome c oxidase complex. This subunit does not have a catalytic capacity but instead, is required for assembly and/or stability of the complex []. ; GO: 0004129 cytochrome-c oxidase activity, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=29.81  E-value=2e+02  Score=21.19  Aligned_cols=56  Identities=29%  Similarity=0.494  Sum_probs=30.5

Q ss_pred             HHHHHHHHHHHHHhhhhcccChh--hHHHHHHHHHHHHHHHH-Hhhheeee--eecCCCCC
Q 038706           18 AITVFFLLSVAYYAFFAPFLGTE--LYEYVAIGVYSVLAFCV-FILYVRCT--GIDPADPG   73 (127)
Q Consensus        18 ~W~~~~~l~~~~f~~~iP~l~~~--~~~~~~~~v~~~l~~~~-~~~~~~~t--~iDPaD~~   73 (127)
                      .-.+|++.+.+.|++..-....+  +...++..+.+.+.+++ .++.+++-  ...|+|..
T Consensus        10 ~l~~Ff~~~~~vY~~~t~~~~~~~E~~Gt~aL~ls~~l~~mig~yl~~~~rr~~~rPED~~   70 (137)
T PF12270_consen   10 GLAVFFLVVAVVYGFWTKWSGDGGEWVGTVALVLSGGLALMIGFYLRFTARRIGPRPEDRE   70 (137)
T ss_pred             HHHHHHHHHHHHHHHHHhccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHhhCCCCCcccc
Confidence            34567777788888888766111  13344444555555443 34444443  45566654


No 28 
>PF11947 DUF3464:  Protein of unknown function (DUF3464);  InterPro: IPR021855  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 137 to 196 amino acids in length. 
Probab=29.51  E-value=44  Score=25.03  Aligned_cols=31  Identities=19%  Similarity=0.179  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHhhheeeeeecCCCCCCcc
Q 038706           46 AIGVYSVLAFCVFILYVRCTGIDPADPGILI   76 (127)
Q Consensus        46 ~~~v~~~l~~~~~~~~~~~t~iDPaD~~v~~   76 (127)
                      ...++.++.++=+.+.+-.++=||+.++...
T Consensus       102 ~S~~~Fg~gllGisYGilSaSWD~~r~GSll  132 (153)
T PF11947_consen  102 VSLVFFGLGLLGISYGILSASWDPEREGSLL  132 (153)
T ss_pred             HHHHHHHHHHHhhhhhhcccccCCCCCCCcc
Confidence            3334434444456677788889999887654


No 29 
>PF07010 Endomucin:  Endomucin;  InterPro: IPR010740 This family consists of several mammalian endomucin proteins. Endomucin is an early endothelial-specific antigen that is also expressed on putative hematopoietic progenitor cells.
Probab=28.97  E-value=68  Score=25.90  Aligned_cols=32  Identities=28%  Similarity=0.371  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHHHHhhheeeeeecCCCCCCccC
Q 038706           46 AIGVYSVLAFCVFILYVRCTGIDPADPGILIE   77 (127)
Q Consensus        46 ~~~v~~~l~~~~~~~~~~~t~iDPaD~~v~~~   77 (127)
                      +.++..++++..+.+|-.|-..||.+|..-.+
T Consensus       196 aliVitl~vf~LvgLyr~C~k~dPg~p~~g~~  227 (259)
T PF07010_consen  196 ALIVITLSVFTLVGLYRMCWKTDPGTPENGPD  227 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHhhcCCCCCcccCCC
Confidence            34455667777788899999999999876543


No 30 
>PF12666 PrgI:  PrgI family protein;  InterPro: IPR024414 This family of bacterial proteins is functionally uncharacterised. Proteins in this family are typically between 116 and 146 amino acids in length. PrgI is found encoded on plasmids of Enterococcus faecalis, its function is not known. 
Probab=28.78  E-value=1.7e+02  Score=19.08  Aligned_cols=30  Identities=23%  Similarity=0.328  Sum_probs=25.4

Q ss_pred             CCChhHHHHHHHHHHHHHHHHhhhhcccCh
Q 038706           10 PAHTFQVVAITVFFLLSVAYYAFFAPFLGT   39 (127)
Q Consensus        10 Plh~~Qv~~W~~~~~l~~~~f~~~iP~l~~   39 (127)
                      ++..-|++.-+..++.++..|.++-++++.
T Consensus        16 GlT~RQl~~l~~~~~~~~~~~~~~~~~l~~   45 (93)
T PF12666_consen   16 GLTLRQLICLAIGALVGVGVYLLLWFFLGP   45 (93)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHhccH
Confidence            566789999999998999999888888875


No 31 
>PF11289 DUF3092:  Protein of unknown function (DUF3092);  InterPro: IPR024407 This family of SARS coronavirus proteins includes Orf3/3a, which form homotetrameric potassium sensitive ion channels (viroporin) and may modulate virus release. They have also been shown to up-regulate expression of fibrinogen subunits FGA, FGB and FGG in host lung epithelial cells [, , ].
Probab=28.48  E-value=1.4e+02  Score=23.94  Aligned_cols=43  Identities=23%  Similarity=0.211  Sum_probs=25.9

Q ss_pred             hhcccChhhHHHHHHHHHHHHHHHHHhhheeeeeecC--CCCCCc
Q 038706           33 FAPFLGTELYEYVAIGVYSVLAFCVFILYVRCTGIDP--ADPGIL   75 (127)
Q Consensus        33 ~iP~l~~~~~~~~~~~v~~~l~~~~~~~~~~~t~iDP--aD~~v~   75 (127)
                      -.|+|-....-+++..++..-+++-.++.++|-+-+|  +|++-+
T Consensus       102 E~~fLyl~aliy~lq~~~~~r~~~RcwLcwkC~SknPLlyD~NyF  146 (273)
T PF11289_consen  102 EAPFLYLYALIYFLQCVSFCRIIMRCWLCWKCKSKNPLLYDANYF  146 (273)
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccCCceeecCceE
Confidence            3455544333444444554555556789999999998  455543


No 32 
>COG1585 Membrane protein implicated in regulation of membrane protease activity [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=26.82  E-value=2.2e+02  Score=20.69  Aligned_cols=31  Identities=23%  Similarity=0.181  Sum_probs=16.4

Q ss_pred             hhhcccChhhHHHHHHHHHHHHHHHHHhhhee
Q 038706           32 FFAPFLGTELYEYVAIGVYSVLAFCVFILYVR   63 (127)
Q Consensus        32 ~~iP~l~~~~~~~~~~~v~~~l~~~~~~~~~~   63 (127)
                      ...|..+. .+|.+++++++++......-.++
T Consensus        40 ~~l~~~~~-~~q~v~f~~lsv~~~~l~rr~~~   70 (140)
T COG1585          40 ALLLLLSW-WLQLVLFAILSVLLALLGRRFVR   70 (140)
T ss_pred             HHHccchH-HHHHHHHHHHHHHHHHHHHHHHh
Confidence            34455544 35676776666555544433333


No 33 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=26.79  E-value=41  Score=17.09  Aligned_cols=12  Identities=25%  Similarity=0.177  Sum_probs=9.1

Q ss_pred             CccccccccccC
Q 038706           95 KYSDNSQIRVLS  106 (127)
Q Consensus        95 ~~C~lC~i~V~~  106 (127)
                      .||.+|+....+
T Consensus         2 ~~C~~C~k~f~~   13 (27)
T PF12171_consen    2 FYCDACDKYFSS   13 (27)
T ss_dssp             CBBTTTTBBBSS
T ss_pred             CCcccCCCCcCC
Confidence            479999986653


No 34 
>PF11241 DUF3043:  Protein of unknown function (DUF3043);  InterPro: IPR021403  Some members in this family of proteins with unknown function are annotated as membrane proteins. This cannot be confirmed. 
Probab=26.70  E-value=2.2e+02  Score=21.66  Aligned_cols=18  Identities=11%  Similarity=0.113  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHHHhhh
Q 038706           16 VVAITVFFLLSVAYYAFF   33 (127)
Q Consensus        16 v~~W~~~~~l~~~~f~~~   33 (127)
                      +..|++.+.++++...++
T Consensus        77 i~e~fmP~alv~lv~~~v   94 (170)
T PF11241_consen   77 IGEFFMPVALVLLVLSFV   94 (170)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            445666655555555555


No 35 
>TIGR00383 corA magnesium Mg(2+) and cobalt Co(2+) transport protein (corA). The article in Microb Comp Genomics 1998;3(3):151-69 (Medline:98448512) discusses this family and suggests that some members may have functions other than Mg2+ transport.
Probab=26.16  E-value=1.5e+02  Score=23.60  Aligned_cols=32  Identities=19%  Similarity=0.238  Sum_probs=16.0

Q ss_pred             HHHHHHHHhhhhcccChhhHHHHHHHHHHHHH
Q 038706           23 FLLSVAYYAFFAPFLGTELYEYVAIGVYSVLA   54 (127)
Q Consensus        23 ~~l~~~~f~~~iP~l~~~~~~~~~~~v~~~l~   54 (127)
                      +.++.+.||-=++.+|..-|.+.-.++.++++
T Consensus       271 ~t~IaGiyGMNf~~mP~l~~~~gy~~~l~~m~  302 (318)
T TIGR00383       271 LTFIAGIYGMNFKFMPELNWKYGYPAVLIVMA  302 (318)
T ss_pred             HHHHHHHHhCCcccCccccchhHHHHHHHHHH
Confidence            34456678876555554334443333433333


No 36 
>COG0577 SalY ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms]
Probab=25.84  E-value=1.4e+02  Score=23.06  Aligned_cols=15  Identities=13%  Similarity=0.408  Sum_probs=11.8

Q ss_pred             HhhheeeeeecCCCC
Q 038706           58 FILYVRCTGIDPADP   72 (127)
Q Consensus        58 ~~~~~~~t~iDPaD~   72 (127)
                      ++...++..+||.|.
T Consensus       401 ~~pa~~~~~~~~~~~  415 (419)
T COG0577         401 LLPARKAAKLDPIEA  415 (419)
T ss_pred             HHHHHHHhhcCHHHH
Confidence            567788888998875


No 37 
>PF04341 DUF485:  Protein of unknown function, DUF485;  InterPro: IPR007436 This family includes several putative integral membrane proteins.
Probab=25.29  E-value=15  Score=24.72  Aligned_cols=7  Identities=29%  Similarity=0.544  Sum_probs=3.5

Q ss_pred             ecCCCCC
Q 038706           67 IDPADPG   73 (127)
Q Consensus        67 iDPaD~~   73 (127)
                      .||--..
T Consensus        81 ~D~l~~~   87 (91)
T PF04341_consen   81 FDPLARA   87 (91)
T ss_pred             cCHHHHH
Confidence            6664433


No 38 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=25.08  E-value=45  Score=16.90  Aligned_cols=16  Identities=13%  Similarity=0.063  Sum_probs=8.2

Q ss_pred             ccccccccccCCCCcc
Q 038706           96 YSDNSQIRVLSAESGR  111 (127)
Q Consensus        96 ~C~lC~i~V~~~tKHC  111 (127)
                      ||.-|+..+.+.+|-|
T Consensus         1 ~Cp~CG~~~~~~~~fC   16 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFC   16 (23)
T ss_pred             CCcccCCCCCCcCcch
Confidence            3555555555555544


No 39 
>PRK13476 cytochrome b6-f complex subunit IV; Provisional
Probab=24.77  E-value=91  Score=23.51  Aligned_cols=10  Identities=40%  Similarity=0.318  Sum_probs=6.4

Q ss_pred             eeecCCCCCC
Q 038706           65 TGIDPADPGI   74 (127)
Q Consensus        65 t~iDPaD~~v   74 (127)
                      ..-|||||..
T Consensus        61 ~LgdpAnPl~   70 (160)
T PRK13476         61 MLGEPADPFA   70 (160)
T ss_pred             hhCCCCCccc
Confidence            3457888854


No 40 
>TIGR00869 sec62 protein translocation protein, Sec62 family. protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins has been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.
Probab=24.66  E-value=1.8e+02  Score=23.29  Aligned_cols=27  Identities=7%  Similarity=0.073  Sum_probs=15.3

Q ss_pred             hHHHHHHHHHHHH-HHHHhhhhcccChh
Q 038706           14 FQVVAITVFFLLS-VAYYAFFAPFLGTE   40 (127)
Q Consensus        14 ~Qv~~W~~~~~l~-~~~f~~~iP~l~~~   40 (127)
                      -|...|+..++++ .+..+.+.|+-|..
T Consensus       115 ~~~~~~l~~~~~~~~ila~~lFPlWP~~  142 (232)
T TIGR00869       115 RPYMDYLIVILVVSIILALVLFPLWPRF  142 (232)
T ss_pred             CcHHHHHHHHHHHHHHHHHhhcccChHH
Confidence            3445555444443 44556677888863


No 41 
>TIGR01156 cytb6/f_IV cytochrome b6/f complex subunit IV. This model describes the subunit IV of the cytochrome b6/f complex. The cyt b6/f complex is central to the functions of the oxygenic phosynthetic electron transport in cyanobacteria and its equivalents in algae and higher plants. Energetically, on the redox scale the cytb6/f complex is placed below the other components - Q(A); Q(B) of the photosystem II in the Z-scheme, along the pathway of the electron transport. The complex is made of the following subunits: cytochrome f; cytochrome b6; Rieske 2Fe-2S; and subunits IV; V; VI; VII. Subunit IV is one of the principal subunits for the binding of the redox prosthetic groups. Each monomer of the complex contains a molecule of chlorophyll a and beta-carotene.
Probab=24.61  E-value=1e+02  Score=23.23  Aligned_cols=12  Identities=25%  Similarity=0.171  Sum_probs=7.6

Q ss_pred             eeeecCCCCCCc
Q 038706           64 CTGIDPADPGIL   75 (127)
Q Consensus        64 ~t~iDPaD~~v~   75 (127)
                      ...-|||||..-
T Consensus        60 ~~Lg~pAnP~~T   71 (159)
T TIGR01156        60 AMIGEPANPFAT   71 (159)
T ss_pred             HhhCCCCCcccC
Confidence            445678888543


No 42 
>PF13126 DUF3975:  Protein of unknown function (DUF3975)
Probab=24.43  E-value=2.2e+02  Score=18.89  Aligned_cols=14  Identities=14%  Similarity=0.069  Sum_probs=10.2

Q ss_pred             hhHHHHHHHHHHHH
Q 038706           13 TFQVVAITVFFLLS   26 (127)
Q Consensus        13 ~~Qv~~W~~~~~l~   26 (127)
                      ..|+++|+......
T Consensus         6 gkq~lawitlgivi   19 (85)
T PF13126_consen    6 GKQILAWITLGIVI   19 (85)
T ss_pred             hhHHHHHHHHHHHH
Confidence            46999998765443


No 43 
>PF14143 YrhC:  YrhC-like protein
Probab=23.44  E-value=2.2e+02  Score=18.62  Aligned_cols=20  Identities=15%  Similarity=0.233  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHhhhhccc
Q 038706           18 AITVFFLLSVAYYAFFAPFL   37 (127)
Q Consensus        18 ~W~~~~~l~~~~f~~~iP~l   37 (127)
                      +.+++.+-++.+.|.++|.-
T Consensus        14 ~~vLLAvs~FlYiG~viP~~   33 (72)
T PF14143_consen   14 AFVLLAVSTFLYIGTVIPIG   33 (72)
T ss_pred             HHHHHHHHHHHHHHhhCCcc
Confidence            44555555566666677733


No 44 
>PF04772 Flu_B_M2:  Influenza B matrix protein 2 (BM2);  InterPro: IPR006859 BM2 is synthesised in the late phase of infection and incorporated into the virion. It may be phosphorylated in vivo. The function of BM2 is unknown [].; PDB: 2LJB_D 2LJC_A 2KIX_B 2KJ1_C.
Probab=23.28  E-value=1.3e+02  Score=20.71  Aligned_cols=19  Identities=26%  Similarity=0.607  Sum_probs=12.5

Q ss_pred             CChhHHHHHHHHHHHHHHH
Q 038706           11 AHTFQVVAITVFFLLSVAY   29 (127)
Q Consensus        11 lh~~Qv~~W~~~~~l~~~~   29 (127)
                      |.|+|+++.-.|++-++-|
T Consensus         2 lep~qilsicsfilsalhf   20 (109)
T PF04772_consen    2 LEPFQILSICSFILSALHF   20 (109)
T ss_dssp             -STTHHHHHHHHHHHHHHH
T ss_pred             CchHHHHHHHHHHHHHHHH
Confidence            5688998887776554433


No 45 
>PRK10845 colicin V production protein; Provisional
Probab=22.57  E-value=2.2e+02  Score=20.93  Aligned_cols=24  Identities=17%  Similarity=0.528  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHHhhhhcccC
Q 038706           15 QVVAITVFFLLSVAYYAFFAPFLG   38 (127)
Q Consensus        15 Qv~~W~~~~~l~~~~f~~~iP~l~   38 (127)
                      =+++|++-++.+.-+|-.+.|.++
T Consensus        30 sl~g~i~a~~~A~~~~~~la~~l~   53 (162)
T PRK10845         30 SLVTWGCAFFVASHYYTYLSVWFT   53 (162)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            357788888888888888888765


No 46 
>PRK11715 inner membrane protein; Provisional
Probab=22.37  E-value=1.3e+02  Score=26.10  Aligned_cols=51  Identities=14%  Similarity=0.217  Sum_probs=24.7

Q ss_pred             CCCCChhHHHHHHHHHHHHHHHHhhhhcccChhhHHHHHHHHHHHHHHHHHhhhe
Q 038706            8 QLPAHTFQVVAITVFFLLSVAYYAFFAPFLGTELYEYVAIGVYSVLAFCVFILYV   62 (127)
Q Consensus         8 ~~Plh~~Qv~~W~~~~~l~~~~f~~~iP~l~~~~~~~~~~~v~~~l~~~~~~~~~   62 (127)
                      ++|+||.|=+-...   -.+.||..++-+-+ +.--..+|.+.+...+..+.+|+
T Consensus       326 ~~~iHpiQYlLVGl---Al~lFYLLLLSlSE-HigF~~AYliAa~a~v~li~~Y~  376 (436)
T PRK11715        326 KLRIHPVQYLLVGL---ALVLFYLLLLSLSE-HIGFTLAYLIAALACVLLIGFYL  376 (436)
T ss_pred             CceecHHHHHHHHH---HHHHHHHHHHHHHh-hhchHHHHHHHHHHHHHHHHHHH
Confidence            46889999653332   12445555554444 33334455554443333333333


No 47 
>PRK09546 zntB zinc transporter; Reviewed
Probab=22.06  E-value=1.4e+02  Score=24.00  Aligned_cols=16  Identities=0%  Similarity=-0.126  Sum_probs=9.7

Q ss_pred             HHHHHHHhhhhcccCh
Q 038706           24 LLSVAYYAFFAPFLGT   39 (127)
Q Consensus        24 ~l~~~~f~~~iP~l~~   39 (127)
                      .++.+.||-=++-+|.
T Consensus       278 T~IaGiyGMNf~~mPe  293 (324)
T PRK09546        278 TFLTGLFGVNLGGIPG  293 (324)
T ss_pred             HHHHhhhccccCCCCC
Confidence            4556678876554444


No 48 
>PF06123 CreD:  Inner membrane protein CreD;  InterPro: IPR010364 This family consists of several bacterial CreD or Cet inner membrane proteins. Dominant mutations of the cet gene of Escherichia coli result in tolerance to colicin E2 and increased amounts of an inner membrane protein with a Mr of 42,000. The cet gene is shown to be in the same operon as the phoM gene, which is required in a phoR background for expression of the structural gene for alkaline phosphatase, phoA. Although the Cet protein is not required for phoA expression, it has been suggested that the Cet protein has an enhancing effect on the transcription of phoA [].
Probab=21.68  E-value=1.5e+02  Score=25.75  Aligned_cols=50  Identities=16%  Similarity=0.248  Sum_probs=25.7

Q ss_pred             CCCChhHHHHHHHHHHHHHHHHhhhhcccChhhHHHHHHHHHHHHHHHHHhhhe
Q 038706            9 LPAHTFQVVAITVFFLLSVAYYAFFAPFLGTELYEYVAIGVYSVLAFCVFILYV   62 (127)
Q Consensus         9 ~Plh~~Qv~~W~~~~~l~~~~f~~~iP~l~~~~~~~~~~~v~~~l~~~~~~~~~   62 (127)
                      ++.||.|=+-....   .++||..++-+-+ +.--..+|.+.+...+..+.+|.
T Consensus       321 ~~iHpiQY~LVGlA---l~lFYlLLLSlSE-hi~F~~AYliAa~a~i~Li~~Y~  370 (430)
T PF06123_consen  321 LRIHPIQYLLVGLA---LVLFYLLLLSLSE-HIGFNLAYLIAALACIGLISLYL  370 (430)
T ss_pred             CcccHHHHHHHHHH---HHHHHHHHHHHHh-hhchHHHHHHHHHHHHHHHHHHH
Confidence            68899996543332   2445555555544 33344455555444444444443


No 49 
>KOG2927 consensus Membrane component of ER protein translocation complex [Intracellular trafficking, secretion, and vesicular transport]
Probab=21.65  E-value=46  Score=28.34  Aligned_cols=24  Identities=13%  Similarity=0.087  Sum_probs=12.5

Q ss_pred             HHHHHHHHHH-HHHHhhhhcccChh
Q 038706           17 VAITVFFLLS-VAYYAFFAPFLGTE   40 (127)
Q Consensus        17 ~~W~~~~~l~-~~~f~~~iP~l~~~   40 (127)
                      +.|++-++++ ++.-+.+.|+-|..
T Consensus       189 ~~~vl~~~fvl~tlaivLFPLWP~~  213 (372)
T KOG2927|consen  189 MWQVLGVLFVLVTLAIVLFPLWPRR  213 (372)
T ss_pred             hHHHHHHHHHHHHHHHHhcccCcHH
Confidence            3444433334 34445567888764


No 50 
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=21.50  E-value=20  Score=21.76  Aligned_cols=17  Identities=18%  Similarity=0.309  Sum_probs=13.2

Q ss_pred             CCccccccccccCCCCc
Q 038706           94 GKYSDNSQIRVLSAESG  110 (127)
Q Consensus        94 n~~C~lC~i~V~~~tKH  110 (127)
                      .+||+.|...-.+-.+|
T Consensus         5 ~GYCE~C~~ky~~l~~H   21 (49)
T PF07535_consen    5 PGYCENCRVKYDDLEEH   21 (49)
T ss_pred             CccCccccchhhhHHHH
Confidence            47999999887765555


No 51 
>PRK10527 hypothetical protein; Provisional
Probab=21.48  E-value=1.8e+02  Score=20.83  Aligned_cols=19  Identities=16%  Similarity=0.240  Sum_probs=14.8

Q ss_pred             HHHHHHHHhhhhcccChhh
Q 038706           23 FLLSVAYYAFFAPFLGTEL   41 (127)
Q Consensus        23 ~~l~~~~f~~~iP~l~~~~   41 (127)
                      +.++++.-|+++|.||..+
T Consensus        12 ~~~~LG~iGi~LPlLPTTP   30 (125)
T PRK10527         12 LAVVLGTLGVVLPLLPTTP   30 (125)
T ss_pred             HHHHHHHHHHhccCCCCcH
Confidence            3466778899999999854


No 52 
>KOG2612 consensus Predicted integral membrane protein [Function unknown]
Probab=20.47  E-value=57  Score=22.58  Aligned_cols=48  Identities=8%  Similarity=-0.123  Sum_probs=32.6

Q ss_pred             hhheeeeeecCCCCCCccCCCcc--ccccccCCCCCCCCccccccccccC
Q 038706           59 ILYVRCTGIDPADPGILIEPDKI--SAYKLQNDTDLPGKYSDNSQIRVLS  106 (127)
Q Consensus        59 ~~~~~~t~iDPaD~~v~~~~~~~--~~drsk~~hvi~n~~C~lC~i~V~~  106 (127)
                      ...+++.--.|.|+.-|....+.  .|.-+|.+.--++..|.-|+..|..
T Consensus        37 l~k~~~~D~rpedssY~f~~~gnLDI~Giqkqaek~~~~hCeNC~RdVaA   86 (103)
T KOG2612|consen   37 LGKLAALDGRPEDSSYRFCEMGNLDIFGIQKQAEKPMDCHCENCDRDVAA   86 (103)
T ss_pred             HhccccCCCCccccceeecCCCCcchhhhhhhccCCccccCCCCccHHHH
Confidence            34566666779998887755443  4555555555566789999988863


No 53 
>PF04120 Iron_permease:  Low affinity iron permease ;  InterPro: IPR007251  Although originally identified as a low-affinity iron(II) permease [, ], Fet4 has since been shown to import several other transition metal ions, including copper [, ] and zinc []. Copper, cobalt, and cadmium inhibit Fet4 [, ]. Fet4 is an integral protein of the plasma membrane [, ]. FET4 is not essential, not even in fet3 fet4 double mutants []. Over expression of FET4 improves growth under alkaline conditions [].   Transcription of FET4 is induced by Aft1 in response to low levels of iron [, , ] or by Zap1 in response to low zinc [, ], but not in response to low copper []. When the high-affinity iron permease component Fet3 is deleted, FET4 is induced by the addition of copper, zinc, cobalt, or manganese []. It is also induced under anaerobic conditions [, , ] and repressed by Rox1 in aerobic conditions [, ]. Rox1 attenuates the activation of FET4 by Aft1 or Zap1 []. ; GO: 0055085 transmembrane transport
Probab=20.17  E-value=2.6e+02  Score=20.28  Aligned_cols=29  Identities=14%  Similarity=0.344  Sum_probs=17.5

Q ss_pred             HHHHHHhhhhcccCh-hhHHHHHHHHHHHH
Q 038706           25 LSVAYYAFFAPFLGT-ELYEYVAIGVYSVL   53 (127)
Q Consensus        25 l~~~~f~~~iP~l~~-~~~~~~~~~v~~~l   53 (127)
                      .+++..++..|++.- ..||.+.....+++
T Consensus        23 ~~Ii~W~i~Gp~~~~sdtWQLviNt~ttIi   52 (132)
T PF04120_consen   23 AVIIVWAISGPVFGFSDTWQLVINTATTII   52 (132)
T ss_pred             HHHHHHHHHhccccCcchHHHHHccHHHHH
Confidence            345555666677654 34888776555554


Done!