Citrus Sinensis ID: 038717


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
QRQRPYLKLGVKARGCNGLSYTLNYADERAKFDELVEDKGVKILIDPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMTTSSSGASKQGGS
cccccEEEEEEcccccccccEEcEEccccccccEEEEEccEEEEEccccccEEccEEEEEEEcccccccEEccccccccccccccEEccccccccccccc
***RPYLKLGVKARGCNGLSYTLNYADERAKFDELVEDKGVKILIDPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFM*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QRQRPYLKLGVKARGCNGLSYTLNYADERAKFDELVEDKGVKILIDPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMTTSSSGASKQGGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Iron-sulfur assembly protein IscA-like 1, mitochondrial Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.probableQ8LBM4
Iron-binding protein IscA Is able to transfer iron-sulfur clusters to apo-ferredoxin. Multiple cycles of [2Fe2S] cluster formation and transfer are observed, suggesting that IscA acts catalytically. Recruits intracellular free iron so as to provide iron for the assembly of transient iron-sulfur cluster in IscU in the presence of IscS, L-cysteine and the thioredoxin reductase system TrxA/TrxB.probableA4WDA9
Iron-sulfur cluster assembly 1 homolog, mitochondrial Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.probableQ9BUE6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1R94, chain A
Confidence level:very confident
Coverage over the Query: 4-78
View the alignment between query and template
View the model in PyMOL