Citrus Sinensis ID: 038745

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-

EKDEDKELDFGSDESEPPLPLTATSRVLYMLGDITAGPAYRFTQWLELVRKRSAKYRSSGFPHRPYRLDTMPVRESLVDPKGPLPTEQPTENSLWERLGKASMLDIESSLFSWDMLSSLHHTEHSSSTDQSEDELNKALEVTVNSGGVVFFALFNQPGSDDAPPKEAAAVIKFSSSRMATQSERLGYEFAKWLGVRTPQARVIHNCSSEWLQIKEAAEKARATATSEGDEIGEMTCSELLEALELSRCLFLMSYVHGSPLLESSSAFESRETAEKTAAALGRVLMLDLVIRNEDRLPCRQLRWRGNPANLLLADKMASANMDAMEEAFDSAIKKYRPRVIRALQKERRTASVDSRVIPHSAGLVSEGSDLSDIIESPKSSELSRRSQTSDESTVSDFHIVAIDSGVPRRPPAGKRANDQANYPKLVELLLNSSEYASNLLHEITGGKLGSPPLEDANLQGFHIFLITLYQKLDGSLRAFLNILNKAPSGDFDKEDYVAPESPSQSAGSVYCQSPPSKERLCNDSHPDYSNTESQKTAPRSSSKESTDSNSPMSRENWHGKFCKGNGEHVRSLRLTAKLRDFHKFAKVDAESNKELEQWNEMLRNDAVKLCQENNFNTGFFEGSDGVVDAYELKVRLEHILERITLISEAANTERPSSITSSLFIGGALAARSVYTLKHLGITHILCLCANEIGQSDSQFPDLFKYKNFSISDNEDTNISSIFEEASDFIDHVEQTGGRVLVHCFEGRSRSATLVLAYLMLRKNFTLLQAWNTLKRVHRRAQPNDGFAKILLELDRKLHGEVSMEWQQRKPMMKVCPICGKNAGLSSSSLKLHLQKSHKKLSSGSVDSAMTMEIQKALDALKISRGGSVSPTQRESSSLLDE

cccHHHcccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccHHHHccEEEEEEEcccEEEEEEEcccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccHHHHccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEEccHHHHccHHHHHHccccEEEEcccccccccccccccccEEEEEECccccccccHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccc

*******************PLTATSRVLYMLGDITAGPAYRFTQWLELVRKRS***************************************SLWERLGKASMLDIESSLFSWDMLSS********************LEVTVNSGGVVFFALFNQP*******K*AAAVIKFSSSRMATQSERLGYEFAKWLGVRTPQARVIHNCSSEWLQIKEAAEKARATATSEGDEIGEMTCSELLEALELSRCLFLMSYVHGSPLLE*************TAAALGRVLMLDLVIRNEDRLPCRQLRWRGNPANLLLADKMASANMDAMEEAFDSAIKKYRPRVI********************************************************FHIVAIDSGVPR************NYPKLVELLLNSSEYASNLLHEITGGKLGSPPLEDANLQGFHIFLITLYQKLDGSLRAFLNILNK**********************************************************************************HVRSLRLTAKLRDFHKFAKVDAE**KELEQWNEMLRNDAVKLCQENNFNTGFFEGSDGVVDAYELKVRLEHILERITLISEAANTERPSSITSSLFIGGALAARSVYTLKHLGITHILCLCANEIGQSDSQFPDLFKYKNFSISDNEDTNISSIFEEASDFIDHVEQTGGRVLVHCFEGRSRSATLVLAYLMLRKNFTLLQAWNTLKRVHRRAQPNDGFAKILLELDRKLHGEV********************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dual specificity protein phosphatase PHS1	Probable dual specificity phosphatase that binds and dephosphorylates MPK18, modulating the organization and dynamics of cortical microtubules. Acts as negative regulator of abscisic acid (ABA) signaling during seed germination and light-induced stomata aperture.	probable	Q75QN6

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NT2, chain A
Confidence level:very confident
Coverage over the Query: 654-799
View the alignment between query and template
View the model in PyMOL

Template: 1CJA, chain A
Confidence level:very confident
Coverage over the Query: 61-72,86-125,145-153,165-316
View the alignment between query and template
View the model in PyMOL

Template: 2ESB, chain A
Confidence level:very confident
Coverage over the Query: 653-819
View the alignment between query and template
View the model in PyMOL

Template: 1OHE, chain A
Confidence level:confident
Coverage over the Query: 618-637,652-793
View the alignment between query and template
View the model in PyMOL