Citrus Sinensis ID: 038769


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFNANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNSPWL
ccEEccccccEEEEEcccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEcccccccccEEEccEEEcccccccEEEEEEcccccEEEEEEccccccccccEEcccccHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHcccccEEEEEccccccc
cccEEccccHHEEEEHHHHHHHHHHHHHHHHHccEcccccccccEcccccHHHHHHHHHHHHHHHHcccEEEEcccEcccccccEccEEEEccccccHHHHccccccEEEEEEEccHHHHHHHHEEEEccEHHHHHHHHHHccccEEEEcccccccccccEcccHHHEEccEcHHHHHHccEEEEEEEEEccccccc
lrvcfthqfpniyvqegIYDEFEKKLVEKAKAwvvgdpfdpavnqgpqinkkQFDRILSYIESGkkegatvltggktvgqkgyyieptiftnvkedmliakdeifGPVMVLMKFNANNRRYGLAAGIitndlntantVSRSIRAGIIWANCylafdndcpyggykmsgfgrdcgldslhKYLHVKSVVtpihnspwl
lrvcfthqfpniyvqegIYDEFEKKLVEKAKAWVVGDPfdpavnqgpqinkKQFDRILSYIEsgkkegatvltggktvgqkgyyIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFNANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVksvvtpihnspwl
LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFNANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNSPWL
**VCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFNANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPI******
LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFNANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNSPW*
LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFNANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNSPWL
LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFNANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNS**L
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFNANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNSPWL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query197 2.2.26 [Sep-21-2011]
Q56YU0501 Aldehyde dehydrogenase fa yes no 0.944 0.371 0.649 4e-73
Q9SU63538 Aldehyde dehydrogenase fa no no 0.939 0.343 0.507 1e-54
Q8S528534 Aldehyde dehydrogenase fa no no 0.939 0.346 0.507 2e-54
Q29491240 Aldehyde dehydrogenase, c N/A no 0.913 0.75 0.531 4e-54
P24549501 Retinal dehydrogenase 1 O yes no 0.913 0.359 0.515 5e-54
P86886500 Retinal dehydrogenase 1 O N/A no 0.923 0.364 0.505 2e-53
P51647501 Retinal dehydrogenase 1 O yes no 0.913 0.359 0.510 4e-53
P51977501 Retinal dehydrogenase 1 O N/A no 0.923 0.363 0.510 9e-53
P48644501 Retinal dehydrogenase 1 O yes no 0.923 0.363 0.510 1e-52
O35945501 Aldehyde dehydrogenase, c no no 0.913 0.359 0.505 1e-52
>sp|Q56YU0|AL2C4_ARATH Aldehyde dehydrogenase family 2 member C4 OS=Arabidopsis thaliana GN=ALDH2C4 PE=1 SV=2 Back     alignment and function desciption
 Score =  274 bits (700), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 126/194 (64%), Positives = 152/194 (78%), Gaps = 8/194 (4%)

Query: 12  IYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATV 71
           ++VQEGIYD+  +KLVEKAK W VGDPFD    QGPQ++K+QF++ILSYIE GK EGAT+
Sbjct: 308 VFVQEGIYDKVVEKLVEKAKDWTVGDPFDSTARQGPQVDKRQFEKILSYIEHGKNEGATL 367

Query: 72  LTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYGL 123
           LTGGK +G KGY+I+PTIF +V EDM I +DEIFGPVM LMKF         ANN +YGL
Sbjct: 368 LTGGKAIGDKGYFIQPTIFADVTEDMKIYQDEIFGPVMSLMKFKTVEEGIKCANNTKYGL 427

Query: 124 AAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLH 183
           AAGI++ D++  NTVSRSI+AGIIW NCY  FD DCPYGGYKMSG  R+ G+D+L  YL 
Sbjct: 428 AAGILSQDIDLINTVSRSIKAGIIWVNCYFGFDLDCPYGGYKMSGNCRESGMDALDNYLQ 487

Query: 184 VKSVVTPIHNSPWL 197
            KSVV P+HNSPW+
Sbjct: 488 TKSVVMPLHNSPWM 501




Involved in ferulic acid and sinapic acid biosynthesis by oxidation of conyferylaldehyde and sinapaldehyde, respectively. Can oxidize L-lactaldehyde. Possesses activity on acetaldehyde and glycolaldehyde in vitro.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|Q9SU63|AL2B4_ARATH Aldehyde dehydrogenase family 2 member B4, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B4 PE=1 SV=1 Back     alignment and function description
>sp|Q8S528|AL2B7_ARATH Aldehyde dehydrogenase family 2 member B7, mitochondrial OS=Arabidopsis thaliana GN=ALDH2B7 PE=2 SV=2 Back     alignment and function description
>sp|Q29491|ALDH2_MACPR Aldehyde dehydrogenase, cytosolic 2 (Fragment) OS=Macroscelides proboscideus PE=2 SV=1 Back     alignment and function description
>sp|P24549|AL1A1_MOUSE Retinal dehydrogenase 1 OS=Mus musculus GN=Aldh1a1 PE=1 SV=5 Back     alignment and function description
>sp|P86886|AL1A1_MESAU Retinal dehydrogenase 1 OS=Mesocricetus auratus GN=ALDH1A1 PE=1 SV=1 Back     alignment and function description
>sp|P51647|AL1A1_RAT Retinal dehydrogenase 1 OS=Rattus norvegicus GN=Aldh1a1 PE=1 SV=3 Back     alignment and function description
>sp|P51977|AL1A1_SHEEP Retinal dehydrogenase 1 OS=Ovis aries GN=ALDH1A1 PE=1 SV=2 Back     alignment and function description
>sp|P48644|AL1A1_BOVIN Retinal dehydrogenase 1 OS=Bos taurus GN=ALDH1A1 PE=2 SV=3 Back     alignment and function description
>sp|O35945|AL1A7_MOUSE Aldehyde dehydrogenase, cytosolic 1 OS=Mus musculus GN=Aldh1a7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
356531249 501 PREDICTED: aldehyde dehydrogenase family 0.949 0.373 0.779 5e-86
357500461 502 Aldehyde dehydrogenase [Medicago truncat 0.944 0.370 0.778 4e-85
356531251 499 PREDICTED: aldehyde dehydrogenase family 0.944 0.372 0.757 4e-85
356520525 501 PREDICTED: aldehyde dehydrogenase family 0.944 0.371 0.773 8e-85
356523743 501 PREDICTED: aldehyde dehydrogenase family 0.984 0.387 0.720 9e-84
357518717 481 Aldehyde dehydrogenase [Medicago truncat 0.984 0.403 0.725 1e-83
356513129 502 PREDICTED: aldehyde dehydrogenase family 0.984 0.386 0.720 2e-83
388495142 497 unknown [Lotus japonicus] 0.984 0.390 0.720 8e-83
255546541 501 aldehyde dehydrogenase, putative [Ricinu 0.984 0.387 0.715 1e-82
357500467 500 Cytosolic aldehyde dehydrogenase [Medica 0.959 0.378 0.741 4e-82
>gi|356531249|ref|XP_003534190.1| PREDICTED: aldehyde dehydrogenase family 2 member C4-like [Glycine max] Back     alignment and taxonomy information
 Score =  322 bits (825), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 152/195 (77%), Positives = 168/195 (86%), Gaps = 8/195 (4%)

Query: 11  NIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGAT 70
            + VQEGIYDEFEKKLVEKAKAWVVGDPFDP V QGPQ++KKQF++ILSYIE GKKEGAT
Sbjct: 307 RVLVQEGIYDEFEKKLVEKAKAWVVGDPFDPKVQQGPQVDKKQFEKILSYIEQGKKEGAT 366

Query: 71  VLTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYG 122
           +LTGGK VG KGYYIEPTIF+NVKEDMLI +DEIFGPVM LMKF         ANN RYG
Sbjct: 367 LLTGGKRVGNKGYYIEPTIFSNVKEDMLIVQDEIFGPVMALMKFKTIEDAIKIANNTRYG 426

Query: 123 LAAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYL 182
           LA+GI+T  L+TANTVSRSIRAGI+W NCY AF ND PYGGYKMSGFGRD G+++LHKYL
Sbjct: 427 LASGIVTKSLDTANTVSRSIRAGIVWINCYFAFGNDIPYGGYKMSGFGRDFGMEALHKYL 486

Query: 183 HVKSVVTPIHNSPWL 197
            VKSVVTPI+NSPWL
Sbjct: 487 QVKSVVTPIYNSPWL 501




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357500461|ref|XP_003620519.1| Aldehyde dehydrogenase [Medicago truncatula] gi|355495534|gb|AES76737.1| Aldehyde dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356531251|ref|XP_003534191.1| PREDICTED: aldehyde dehydrogenase family 2 member C4-like [Glycine max] Back     alignment and taxonomy information
>gi|356520525|ref|XP_003528912.1| PREDICTED: aldehyde dehydrogenase family 2 member C4-like [Glycine max] Back     alignment and taxonomy information
>gi|356523743|ref|XP_003530494.1| PREDICTED: aldehyde dehydrogenase family 2 member C4-like [Glycine max] Back     alignment and taxonomy information
>gi|357518717|ref|XP_003629647.1| Aldehyde dehydrogenase [Medicago truncatula] gi|357521041|ref|XP_003630809.1| Aldehyde dehydrogenase [Medicago truncatula] gi|355523669|gb|AET04123.1| Aldehyde dehydrogenase [Medicago truncatula] gi|355524831|gb|AET05285.1| Aldehyde dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356513129|ref|XP_003525266.1| PREDICTED: aldehyde dehydrogenase family 2 member C4-like [Glycine max] Back     alignment and taxonomy information
>gi|388495142|gb|AFK35637.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255546541|ref|XP_002514330.1| aldehyde dehydrogenase, putative [Ricinus communis] gi|223546786|gb|EEF48284.1| aldehyde dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357500467|ref|XP_003620522.1| Cytosolic aldehyde dehydrogenase [Medicago truncatula] gi|355495537|gb|AES76740.1| Cytosolic aldehyde dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query197
TAIR|locus:505006369501 ALDH2C4 "AT3G24503" [Arabidops 0.944 0.371 0.649 2.4e-67
TAIR|locus:2097845538 ALDH2B4 "AT3G48000" [Arabidops 0.939 0.343 0.507 3.1e-51
MGI|MGI:1353450501 Aldh1a1 "aldehyde dehydrogenas 0.913 0.359 0.515 1.3e-50
TAIR|locus:2034855534 ALDH2B7 "AT1G23800" [Arabidops 0.939 0.346 0.507 1.7e-50
RGD|2087501 Aldh1a1 "aldehyde dehydrogenas 0.913 0.359 0.510 7.4e-50
UNIPROTKB|P48644501 ALDH1A1 "Retinal dehydrogenase 0.913 0.359 0.515 2e-49
UNIPROTKB|E2RMX7496 ALDH1A1 "Uncharacterized prote 0.913 0.362 0.521 3.2e-49
UNIPROTKB|J9NS92501 ALDH1A1 "Uncharacterized prote 0.913 0.359 0.521 3.2e-49
UNIPROTKB|P00352501 ALDH1A1 "Retinal dehydrogenase 0.913 0.359 0.505 3.2e-49
MGI|MGI:1347050501 Aldh1a7 "aldehyde dehydrogenas 0.913 0.359 0.505 3.2e-49
TAIR|locus:505006369 ALDH2C4 "AT3G24503" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 684 (245.8 bits), Expect = 2.4e-67, P = 2.4e-67
 Identities = 126/194 (64%), Positives = 152/194 (78%)

Query:    12 IYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATV 71
             ++VQEGIYD+  +KLVEKAK W VGDPFD    QGPQ++K+QF++ILSYIE GK EGAT+
Sbjct:   308 VFVQEGIYDKVVEKLVEKAKDWTVGDPFDSTARQGPQVDKRQFEKILSYIEHGKNEGATL 367

Query:    72 LTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYGL 123
             LTGGK +G KGY+I+PTIF +V EDM I +DEIFGPVM LMKF         ANN +YGL
Sbjct:   368 LTGGKAIGDKGYFIQPTIFADVTEDMKIYQDEIFGPVMSLMKFKTVEEGIKCANNTKYGL 427

Query:   124 AAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLH 183
             AAGI++ D++  NTVSRSI+AGIIW NCY  FD DCPYGGYKMSG  R+ G+D+L  YL 
Sbjct:   428 AAGILSQDIDLINTVSRSIKAGIIWVNCYFGFDLDCPYGGYKMSGNCRESGMDALDNYLQ 487

Query:   184 VKSVVTPIHNSPWL 197
              KSVV P+HNSPW+
Sbjct:   488 TKSVVMPLHNSPWM 501




GO:0004028 "3-chloroallyl aldehyde dehydrogenase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004029 "aldehyde dehydrogenase (NAD) activity" evidence=ISS
GO:0009699 "phenylpropanoid biosynthetic process" evidence=IDA
GO:0050269 "coniferyl-aldehyde dehydrogenase activity" evidence=IDA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
TAIR|locus:2097845 ALDH2B4 "AT3G48000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1353450 Aldh1a1 "aldehyde dehydrogenase family 1, subfamily A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2034855 ALDH2B7 "AT1G23800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|2087 Aldh1a1 "aldehyde dehydrogenase 1 family, member A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P48644 ALDH1A1 "Retinal dehydrogenase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMX7 ALDH1A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NS92 ALDH1A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P00352 ALDH1A1 "Retinal dehydrogenase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1347050 Aldh1a7 "aldehyde dehydrogenase family 1, subfamily A7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_XVIII000233
coniferyl-aldehyde dehydrogenase (EC-1.2.1.68) (497 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.8531.4.1
hypothetical protein (134 aa)
       0.899
gw1.22067.3.1
annotation not avaliable (155 aa)
       0.899
Ptr4CL3
SubName- Full=4-coumarate-CoA ligase; (541 aa)
       0.899
Ptr4CL4
SubName- Full=Putative uncharacterized protein; (570 aa)
       0.899
f5h
SubName- Full=Ferulate-5-hydroxylase; Flags- Precursor; (501 aa)
       0.899
SAD
SubName- Full=Cinnamyl alcohol dehydrogenase; (362 aa)
       0.899
ACLL14
acyl-coa ligase (EC-6.2.1.12) (545 aa)
       0.899
eugene3.00071182
SubName- Full=Ferulate 5-hydroxylase; (515 aa)
       0.899
Ptr4CL8
4-coumarate-coa ligase (544 aa)
       0.899
ACLL12
4-coumarate-coa ligase (544 aa)
       0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 1e-127
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 1e-97
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 2e-94
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 4e-92
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 1e-87
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 2e-84
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 7e-79
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 1e-76
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 1e-75
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 3e-73
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 4e-71
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 6e-71
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 1e-70
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 2e-70
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 1e-66
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 2e-65
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 3e-64
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 5e-64
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 6e-64
cd07119482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 3e-63
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 4e-63
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 4e-63
cd07559480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 2e-60
cd07140486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 2e-59
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 6e-59
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 1e-58
TIGR01804467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 3e-57
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 1e-56
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 2e-56
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 6e-55
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 1e-54
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 8e-54
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 2e-53
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 1e-52
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 4e-51
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 4e-51
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 4e-50
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 2e-49
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 3e-49
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 1e-48
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 7e-48
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 1e-47
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 2e-47
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 4e-47
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 5e-47
cd07116479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 6e-47
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 1e-46
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 3e-46
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 1e-45
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 3e-45
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 8e-45
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 1e-44
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 2e-44
cd07113477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 3e-43
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 5e-43
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 3e-42
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 1e-39
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 2e-38
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 6e-38
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 1e-37
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 2e-37
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 2e-37
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 2e-36
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 2e-36
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 2e-36
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 7e-36
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 8e-36
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 3e-35
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 8e-35
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 8e-35
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 9e-33
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 1e-31
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 2e-31
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 4e-28
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 3e-27
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 5e-27
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 2e-26
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 8e-24
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 4e-23
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 1e-22
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 4e-22
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 9e-22
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 2e-21
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 1e-19
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 1e-19
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 4e-19
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 2e-17
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 2e-17
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 3e-17
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 8e-15
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 9e-15
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 2e-14
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 6e-14
PRK11905 1208 PRK11905, PRK11905, bifunctional proline dehydroge 7e-14
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 9e-14
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 1e-13
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 7e-13
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 3e-12
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 2e-11
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 6e-11
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 7e-11
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 6e-09
PRK11903521 PRK11903, PRK11903, aldehyde dehydrogenase; Provis 9e-09
cd07128513 cd07128, ALDH_MaoC-N, N-terminal domain of the mon 3e-08
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 3e-07
TIGR02278 663 TIGR02278, PaaN-DH, phenylacetic acid degradation 1e-05
PRK11563 675 PRK11563, PRK11563, bifunctional aldehyde dehydrog 2e-05
PRK11809 1318 PRK11809, putA, trifunctional transcriptional regu 7e-04
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
 Score =  367 bits (945), Expect = e-127
 Identities = 145/194 (74%), Positives = 163/194 (84%), Gaps = 8/194 (4%)

Query: 12  IYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATV 71
           +YVQEGIYDEF KKLVEKAK WVVGDPFDP   QGPQ++K+QF++ILSYIE GK+EGAT+
Sbjct: 308 VYVQEGIYDEFVKKLVEKAKDWVVGDPFDPRARQGPQVDKQQFEKILSYIEHGKREGATL 367

Query: 72  LTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYGL 123
           LTGGK  G KGYYIEPTIFT+V EDM IA+DEIFGPVM LMKF         ANN +YGL
Sbjct: 368 LTGGKPCGDKGYYIEPTIFTDVTEDMKIAQDEIFGPVMSLMKFKTVEEAIKKANNTKYGL 427

Query: 124 AAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLH 183
           AAGI+T DL+ ANTVSRSIRAG IW NCY AFD DCP+GGYKMSGFGRD G+D+L KYL 
Sbjct: 428 AAGIVTKDLDVANTVSRSIRAGTIWVNCYFAFDPDCPFGGYKMSGFGRDQGMDALDKYLQ 487

Query: 184 VKSVVTPIHNSPWL 197
           VKSVVTP++NSPWL
Sbjct: 488 VKSVVTPLYNSPWL 501


Length = 501

>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|237016 PRK11903, PRK11903, aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143446 cd07128, ALDH_MaoC-N, N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>gnl|CDD|131331 TIGR02278, PaaN-DH, phenylacetic acid degradation protein paaN Back     alignment and domain information
>gnl|CDD|236931 PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 197
KOG2450501 consensus Aldehyde dehydrogenase [Energy productio 100.0
PLN02766501 coniferyl-aldehyde dehydrogenase 100.0
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 100.0
PLN02466538 aldehyde dehydrogenase family 2 member 100.0
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 100.0
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 100.0
PRK10090409 aldehyde dehydrogenase A; Provisional 100.0
PLN02174484 aldehyde dehydrogenase family 3 member H1 100.0
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 100.0
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 100.0
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 100.0
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 100.0
KOG2451503 consensus Aldehyde dehydrogenase [Energy productio 100.0
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 100.0
PLN02278498 succinic semialdehyde dehydrogenase 100.0
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 100.0
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 100.0
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 100.0
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 100.0
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 100.0
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 100.0
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 100.0
PRK13252488 betaine aldehyde dehydrogenase; Provisional 100.0
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 100.0
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 100.0
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 100.0
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 100.0
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 100.0
PLN02315508 aldehyde dehydrogenase family 7 member 100.0
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 100.0
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 100.0
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 100.0
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 100.0
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 100.0
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 100.0
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 100.0
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 100.0
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 100.0
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 100.0
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 100.0
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 100.0
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 100.0
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 100.0
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 100.0
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 100.0
PLN02467503 betaine aldehyde dehydrogenase 100.0
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 100.0
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 100.0
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 100.0
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 100.0
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 100.0
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 100.0
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 100.0
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 100.0
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 100.0
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 100.0
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 100.0
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 100.0
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 100.0
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 100.0
PLN02203484 aldehyde dehydrogenase 100.0
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 100.0
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 100.0
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 100.0
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 100.0
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 100.0
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 100.0
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 100.0
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 100.0
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 100.0
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 100.0
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 100.0
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 100.0
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 100.0
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 100.0
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 100.0
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 100.0
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 100.0
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 100.0
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 100.0
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 100.0
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 100.0
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 100.0
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 100.0
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 100.0
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 100.0
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 100.0
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 100.0
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 100.0
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 100.0
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 100.0
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 100.0
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 100.0
PRK11903521 aldehyde dehydrogenase; Provisional 100.0
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 100.0
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 100.0
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 100.0
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 100.0
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 100.0
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 100.0
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
KOG2454583 consensus Betaine aldehyde dehydrogenase [Energy p 100.0
PRK11809 1318 putA trifunctional transcriptional regulator/proli 100.0
KOG2456477 consensus Aldehyde dehydrogenase [Energy productio 100.0
KOG2452881 consensus Formyltetrahydrofolate dehydrogenase [Nu 100.0
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 100.0
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 100.0
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 100.0
KOG2453507 consensus Aldehyde dehydrogenase [Energy productio 100.0
KOG2455561 consensus Delta-1-pyrroline-5-carboxylate dehydrog 100.0
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 100.0
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 100.0
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 100.0
PRK15398465 aldehyde dehydrogenase EutE; Provisional 100.0
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 99.98
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 99.97
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 99.97
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 99.97
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 99.97
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 99.97
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 99.97
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 99.96
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.96
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 99.96
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 99.95
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 99.92
KOG2449157 consensus Methylmalonate semialdehyde dehydrogenas 99.63
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 98.27
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 97.99
cd07080422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 97.81
PF05893399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 93.69
KOG4165433 consensus Gamma-glutamyl phosphate reductase [Amin 93.17
KOG2450 501 consensus Aldehyde dehydrogenase [Energy productio 92.89
>KOG2450 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=7.6e-54  Score=366.58  Aligned_cols=194  Identities=54%  Similarity=0.958  Sum_probs=187.8

Q ss_pred             CceeeecCCCEEEEeCccHHHHHHHHHHHHhc-cccCCCCCCCCcccccCCHHHHHHHHHHHHHHHHcCCEEEeCCceeC
Q 038769            1 LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKA-WVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVG   79 (197)
Q Consensus         1 GQ~C~ap~~~rv~V~~~v~d~f~~~l~~~~~~-l~vG~p~~~~~~~Gpli~~~~~~~~~~~i~~a~~~Ga~~~~gg~~~~   79 (197)
                      ||.|++  ++|+|||++|||+|+++++++..+ +++|||.++.+..||.+++.|++|+++||+.++++||++++||.+..
T Consensus       299 Gq~C~a--~sR~~Vqe~iydefv~~~v~~a~~~~kvGdP~~~~~~qG~~i~~~q~ekI~~yi~~~k~eGa~l~~gG~~~g  376 (501)
T KOG2450|consen  299 GQCCTA--GSRVFVQESIYDEFVEKFVAAAKKKLKVGDPFDEGTEQGPQISKTQYEKILGYIESGKKEGATLLCGGVRLG  376 (501)
T ss_pred             cccccc--CceeEEechHHHHHHHHHHHHHhcccccCCCCCcccccccccCHHHHHHHHHHHHHHHhcCCEEEecCcccC
Confidence            899999  889999999999999999999966 99999999999999999999999999999999999999999998765


Q ss_pred             CCCceEecEEEecCCCCCcccccceecceeEEEEEE--------ecCCCCcceeEEeeCChHHHHHHHhhcceeEEEECC
Q 038769           80 QKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANC  151 (197)
Q Consensus        80 ~~g~~~~Ptv~~~~~~~~~~~~eE~FGPvl~v~~~~--------~n~~~~gL~~~v~t~d~~~~~~~~~~l~~G~v~iN~  151 (197)
                      +.|+|+.|||+.++..+|.+++|||||||++|++|+        +|++.|||+++|||+|.++++++++.+++|+||||+
T Consensus       377 ~~Gyfi~Ptv~~~v~~~m~i~~EEIFGPVv~v~~F~t~eE~i~~AN~t~yGLAa~V~t~dl~~a~~va~~l~aGtVwiN~  456 (501)
T KOG2450|consen  377 DKGYFIKPTVFTNVTDDMRIAKEEIFGPVVVVLKFKTEEEVIERANNTTYGLAAGVFTKDLDKAHRVANALQAGTVWINC  456 (501)
T ss_pred             CCceEECCeeccCCChhhhhhHhhccCceEEEEecCcHHHHHHHhcCCcccceeeEeccChHHHHHHHHHhcCceEEEec
Confidence            689999999999999999999999999999999999        999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCcCCCCCCCCCCcchHHHHHhcccccEEEEeCCCCCC
Q 038769          152 YLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNSPW  196 (197)
Q Consensus       152 ~~~~~~~~pfGG~~~SG~G~~~g~~~~~~f~~~k~v~~~~~~~~~  196 (197)
                      +....+..||||+|+||+||+.|.+++.+|++.|+|+++.+.+.|
T Consensus       457 y~~~~~~~PfgG~K~SG~GRE~g~~~l~~ytevKtv~v~~~~~~~  501 (501)
T KOG2450|consen  457 YNVFDAQVPFGGFKMSGIGRELGEYGLEAYTEVKTVTVKLPQKNS  501 (501)
T ss_pred             cccccccCCccccccccCCccccHHHHhhcceeeEEEEeCCCCCC
Confidence            999999999999999999999999999999999999999887654



>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>KOG2451 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2454 consensus Betaine aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2456 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>KOG2453 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2455 consensus Delta-1-pyrroline-5-carboxylate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>KOG2449 consensus Methylmalonate semialdehyde dehydrogenase [Amino acid transport and metabolism; Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information
>KOG4165 consensus Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2450 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
1bxs_A501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 7e-54
1o9j_A501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 2e-53
1bi9_A499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 5e-52
3n80_A500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 1e-50
4fr8_A500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 1e-50
1o05_A500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 1e-50
1nzw_A500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 1e-50
3n81_A500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 1e-50
1cw3_A494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 1e-50
2onn_A500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 4e-50
1ag8_A499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 5e-49
3inl_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 7e-49
1zum_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 8e-49
4a0m_A496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 2e-38
4gnz_A517 Crystal Structure Of The C707s Mutant Of C-terminal 2e-38
3rhr_A517 Crystal Structure Of The C707a Mutant Of The C-Term 2e-38
3rhl_A517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 2e-38
2o2p_A517 Crystal Structure Of The C-Terminal Domain Of Rat 1 2e-38
3rhj_A517 Crystal Structure Of The E673a Mutant Of The C-Term 2e-38
3rhm_A517 Crystal Structure Of The E673q Mutant Of C-Terminal 2e-38
3r31_A517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 3e-37
3iwk_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 9e-37
3iwj_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 1e-36
1a4s_A503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 3e-35
2xdr_A489 Crystallographic Structure Of Betaine Aldehyde Dehy 5e-35
2wox_A489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 5e-35
3zqa_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 5e-35
2wme_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 5e-35
2wme_C490 Crystallographic Structure Of Betaine Aldehyde Dehy 5e-35
4i8p_A520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 1e-33
4i9b_A517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 3e-33
4i8q_A514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 3e-33
2d4e_A515 Crystal Structure Of The Hpcc From Thermus Thermoph 1e-31
3ed6_A520 1.7 Angstrom Resolution Crystal Structure Of Betain 1e-30
3ek1_A504 Crystal Structure Of Aldehyde Dehydrogenase From Br 8e-30
3b4w_A495 Crystal Structure Of Mycobacterium Tuberculosis Ald 2e-29
3ty7_A478 Crystal Structure Of Aldehyde Dehydrogenase Family 2e-29
3u4j_A528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 3e-29
3rjl_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 7e-26
3qan_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 8e-26
1wnb_A495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 1e-25
3i44_A497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 1e-24
3k2w_A497 Crystal Structure Of Betaine-Aldehyde Dehydrogenase 1e-24
3jz4_C481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 2e-24
3jz4_A481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 2e-24
2opx_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 1e-23
2imp_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 1e-23
4dal_A498 Crystal Structure Of Putative Aldehyde Dehydrogenas 2e-23
2hg2_A479 Structure Of Lactaldehyde Dehydrogenase Length = 47 2e-23
3ifg_A484 Crystal Structure Of Succinate-Semialdehyde Dehydro 8e-23
2w8p_A487 The Crystal Structure Of Human C340a Ssadh Length = 2e-22
2w8n_A487 The Crytal Structure Of The Oxidized Form Of Human 2e-22
1t90_A486 Crystal Structure Of Methylmalonate Semialdehyde De 1e-21
1uzb_A516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 3e-21
2bhp_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 3e-21
2bja_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 3e-21
3rh9_A506 The Crystal Structure Of Oxidoreductase From Marino 9e-21
3r64_A508 Crystal Structure Of A Nad-Dependent Benzaldehyde D 2e-20
3efv_A462 Crystal Structure Of A Putative Succinate-Semialdeh 3e-20
2j6l_A500 Structure Of Aminoadipate-Semialdehyde Dehydrogenas 2e-19
2jg7_A510 Crystal Structure Of Seabream Antiquitin And Elucid 2e-19
4dng_A485 Crystal Structure Of Putative Aldehyde Dehydrogenas 2e-18
3pqa_A486 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-18
4f9i_A1026 Crystal Structure Of Proline Utilization A (Puta) F 1e-17
1euh_A475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 1e-15
1qi1_A475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 1e-15
2esd_A475 Crystal Structure Of Thioacylenzyme Intermediate Of 1e-15
2id2_A475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 1e-15
3ros_A484 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 4e-15
1uxv_A501 Structural Basis For Allosteric Regulation And Subs 5e-15
1uxn_A501 Structural Basis For Allosteric Regulation And Subs 1e-14
1ky8_A501 Crystal Structure Of The Non-Phosphorylating Glycer 1e-14
3prl_A505 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 1e-13
4h7n_A474 The Structure Of Putative Aldehyde Dehydrogenase Pu 9e-13
4e4g_A521 Crystal Structure Of Putative Methylmalonate-Semial 2e-11
3v9j_A563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 1e-10
3v9g_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 1e-10
3v9i_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 1e-10
3v9h_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 1e-10
3haz_A1001 Crystal Structure Of Bifunctional Proline Utilizati 1e-08
3lns_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 2e-08
3lv1_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 2e-08
1ad3_A452 Class 3 Aldehyde Dehydrogenase Complex With Nicotin 1e-07
3sza_A469 Crystal Structure Of Human Aldh3a1 - Apo Form Lengt 2e-07
3ju8_A490 Crystal Structure Of Succinylglutamic Semialdehyde 3e-04
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure

Iteration: 1

Score = 206 bits (524), Expect = 7e-54, Method: Compositional matrix adjust. Identities = 97/190 (51%), Positives = 134/190 (70%), Gaps = 8/190 (4%) Query: 12 IYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATV 71 ++V+E IYDEF ++ VE+AK +V+G+P P V+QGPQI+K+Q+++IL IESGKKEGA + Sbjct: 309 LFVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKL 368 Query: 72 LTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKF--------NANNRRYGL 123 GG G KGY+I+PT+F++V +DM IAK+EIFGPV +MKF ANN YGL Sbjct: 369 ECGGGPWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL 428 Query: 124 AAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLH 183 +AGI TND++ A TVS ++++G +W NCY CP+GG+KMSG GR+ G H+Y Sbjct: 429 SAGIFTNDIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGEYGFHEYTE 488 Query: 184 VKSVVTPIHN 193 VK+V I Sbjct: 489 VKTVTIKISQ 498
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|3EK1|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Brucella Melitensis Biovar Abortus 2308 Length = 504 Back     alignment and structure
>pdb|3B4W|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Aldehyde Dehydrogenase Complexed With Nad+ Length = 495 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|3K2W|A Chain A, Crystal Structure Of Betaine-Aldehyde Dehydrogenase From Pseudoalteromonas Atlantica T6c Length = 497 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|3IFG|A Chain A, Crystal Structure Of Succinate-Semialdehyde Dehydrogenase From Burkholderia Pseudomallei, Part 1 Of 2 Length = 484 Back     alignment and structure
>pdb|2W8P|A Chain A, The Crystal Structure Of Human C340a Ssadh Length = 487 Back     alignment and structure
>pdb|2W8N|A Chain A, The Crytal Structure Of The Oxidized Form Of Human Ssadh Length = 487 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure
>pdb|2BHP|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nad. Length = 516 Back     alignment and structure
>pdb|2BJA|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nadh Length = 516 Back     alignment and structure
>pdb|3RH9|A Chain A, The Crystal Structure Of Oxidoreductase From Marinobacter Aquaeolei Length = 506 Back     alignment and structure
>pdb|3R64|A Chain A, Crystal Structure Of A Nad-Dependent Benzaldehyde Dehydrogenase From Corynebacterium Glutamicum Length = 508 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|2J6L|A Chain A, Structure Of Aminoadipate-Semialdehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|2JG7|A Chain A, Crystal Structure Of Seabream Antiquitin And Elucidation Of Its Substrate Specificity Length = 510 Back     alignment and structure
>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 485 Back     alignment and structure
>pdb|3PQA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Gapn From Methanocaldococcus Jannaschii Dsm 2661 Length = 486 Back     alignment and structure
>pdb|4F9I|A Chain A, Crystal Structure Of Proline Utilization A (Puta) From Geobacter Sulfurreducens Pca Length = 1026 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|3ROS|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Lactobacillus Acidophilus Length = 484 Back     alignment and structure
>pdb|1UXV|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|1UXN|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|1KY8|A Chain A, Crystal Structure Of The Non-Phosphorylating Glyceraldehyde-3- Phosphate Dehydrogenase Length = 501 Back     alignment and structure
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Halodurans C-125 Length = 505 Back     alignment and structure
>pdb|4H7N|A Chain A, The Structure Of Putative Aldehyde Dehydrogenase Puta From Anabaena Variabilis. Length = 474 Back     alignment and structure
>pdb|4E4G|A Chain A, Crystal Structure Of Putative Methylmalonate-Semialdehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 521 Back     alignment and structure
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3HAZ|A Chain A, Crystal Structure Of Bifunctional Proline Utilization A (Puta) Protein Length = 1001 Back     alignment and structure
>pdb|3LNS|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ And Benzoate Adduct Length = 457 Back     alignment and structure
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ Length = 457 Back     alignment and structure
>pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide- Adenine-Dinucleotide Length = 452 Back     alignment and structure
>pdb|3SZA|A Chain A, Crystal Structure Of Human Aldh3a1 - Apo Form Length = 469 Back     alignment and structure
>pdb|3JU8|A Chain A, Crystal Structure Of Succinylglutamic Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa. Length = 490 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query197
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 1e-108
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 1e-108
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 1e-108
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 1e-107
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 1e-107
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 1e-106
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 1e-106
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 1e-105
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 1e-105
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 1e-101
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 1e-101
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 2e-99
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 5e-92
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 3e-90
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 3e-89
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 4e-88
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 7e-80
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 2e-77
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 6e-74
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 2e-71
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 6e-71
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 1e-70
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 3e-65
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 6e-65
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 2e-61
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 3e-60
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 4e-60
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 1e-59
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 4e-59
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 6e-59
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 4e-55
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 1e-54
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 1e-54
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 3e-54
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 3e-53
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 6e-53
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 6e-47
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 3e-38
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 1e-37
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 6e-35
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 7e-33
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 1e-31
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 2e-28
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 6e-21
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 2e-19
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 2e-12
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
 Score =  317 bits (815), Expect = e-108
 Identities = 97/188 (51%), Positives = 134/188 (71%), Gaps = 8/188 (4%)

Query: 12  IYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATV 71
           ++V+E IYDEF ++ VE+AK +V+G+P  P V+QGPQI+K+Q+++IL  IESGKKEGA +
Sbjct: 309 LFVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKL 368

Query: 72  LTGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYGL 123
             GG   G KGY+I+PT+F++V +DM IAK+EIFGPV  +MKF         ANN  YGL
Sbjct: 369 ECGGGPWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGL 428

Query: 124 AAGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLH 183
           +AGI TND++ A TVS ++++G +W NCY      CP+GG+KMSG GR+ G    H+Y  
Sbjct: 429 SAGIFTNDIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGEYGFHEYTE 488

Query: 184 VKSVVTPI 191
           VK+V   I
Sbjct: 489 VKTVTIKI 496


>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 100.0
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 100.0
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 100.0
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 100.0
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 100.0
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 100.0
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 100.0
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 100.0
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 100.0
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 100.0
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 100.0
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 100.0
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 100.0
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 100.0
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 100.0
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 100.0
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 100.0
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 100.0
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 100.0
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 100.0
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 100.0
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 100.0
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 100.0
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 100.0
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 100.0
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 100.0
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 100.0
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 100.0
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 100.0
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 100.0
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 100.0
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 100.0
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 100.0
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 100.0
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 100.0
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 100.0
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 100.0
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 100.0
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 100.0
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 100.0
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 100.0
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 100.0
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 100.0
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 100.0
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 99.97
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 99.97
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 99.97
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 99.95
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
Probab=100.00  E-value=6.8e-54  Score=377.50  Aligned_cols=192  Identities=39%  Similarity=0.737  Sum_probs=184.1

Q ss_pred             CceeeecCCCEEEEeCccHHHHHHHHHHHHhccccCCCCCCCCcccccCCHHHHHHHHHHHHHHHHcCCEEEeCCceeC-
Q 038769            1 LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVG-   79 (197)
Q Consensus         1 GQ~C~ap~~~rv~V~~~v~d~f~~~l~~~~~~l~vG~p~~~~~~~Gpli~~~~~~~~~~~i~~a~~~Ga~~~~gg~~~~-   79 (197)
                      ||.|++++  |+|||+++||+|+++|+++++++++|||.++++++|||+++.+++++.++|++++++|+++++||+... 
T Consensus       283 GQ~C~a~~--rv~V~~~i~d~f~~~l~~~~~~l~vGdp~~~~~~~Gpli~~~~~~rv~~~i~~a~~~Ga~v~~gG~~~~~  360 (490)
T 2wme_A          283 GQVCTNGT--RVFIHRSQQARFEAKVLERVQRIRLGDPQDENTNFGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTD  360 (490)
T ss_dssp             GCCTTCCC--EEEEEGGGHHHHHHHHHHHHHTCCBSCTTSTTCCBCCCSCHHHHHHHHHHHHHHHHTTCEEEECCSBCCT
T ss_pred             CCcCCCce--eeccchhHHHHHHHHHHHHHHhCcCCCCccccCccCCcCCHHHHHHHHHHHHHHHhcCCEEEECCcccCc
Confidence            89999966  999999999999999999999999999999999999999999999999999999999999999998643 


Q ss_pred             ---CCCceEecEEEecCCCCCcccccceecceeEEEEEE--------ecCCCCcceeEEeeCChHHHHHHHhhcceeEEE
Q 038769           80 ---QKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYGLAAGIITNDLNTANTVSRSIRAGIIW  148 (197)
Q Consensus        80 ---~~g~~~~Ptv~~~~~~~~~~~~eE~FGPvl~v~~~~--------~n~~~~gL~~~v~t~d~~~~~~~~~~l~~G~v~  148 (197)
                         ..|+|++|||+.+++++|.+++||+||||++|++|+        +|+++|||++||||+|.+++.++++++++|+|+
T Consensus       361 ~~~~~G~~~~Ptvl~~v~~~~~i~~eEiFGPVl~v~~~~~~deAi~~aN~~~yGL~a~v~t~d~~~a~~~~~~l~aG~v~  440 (490)
T 2wme_A          361 GAFGKGAYVAPTVFTDCRDDMTIVREEIFGPVMSILVYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAIHRLEAGICW  440 (490)
T ss_dssp             TTGGGTTCBCCEEEESCCTTSHHHHSCCCSSEEEEEEESCHHHHHHHHHCSSCCSEEEEECSBHHHHHHHHHHSCCSEEE
T ss_pred             ccccCCCccCCEEEEcCCCCChhhhccccCCEEEEEEeCCHHHHHHHHhcCCCCCeEEEEcCCHHHHHHHHHHCCeeEEE
Confidence               269999999999999999999999999999999999        999999999999999999999999999999999


Q ss_pred             ECCCCCCCCCCCcCCCCCCCCCCcchHHHHHhcccccEEEEeCCCC
Q 038769          149 ANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNS  194 (197)
Q Consensus       149 iN~~~~~~~~~pfGG~~~SG~G~~~g~~~~~~f~~~k~v~~~~~~~  194 (197)
                      ||++....+.+||||+|.||+|+++|.+|+++|++.|+|++++++.
T Consensus       441 iN~~~~~~~~~PFGG~k~SG~Gre~G~~gl~~ft~~K~v~i~~g~~  486 (490)
T 2wme_A          441 INTWGESPAEMPVGGYKQSGVGRENGLTTLAHYTRIKSVQVELGDY  486 (490)
T ss_dssp             ESCCSCCCTTSCBCCSGGGEESCBSHHHHHHTTEEEEEEEEECSCC
T ss_pred             EeCCCCCCCCCCcccccccccCchhHHHHHHHhhceeEEEEECCCC
Confidence            9998777789999999999999999999999999999999998753



>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 197
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-67
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-64
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-56
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 1e-52
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 2e-44
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 3e-44
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-36
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-35
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 1e-13
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-13
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]
 Score =  212 bits (540), Expect = 2e-67
 Identities = 95/192 (49%), Positives = 129/192 (67%), Gaps = 10/192 (5%)

Query: 13  YVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVL 72
           +VQE IYDEF ++ V +AK+ VVG+PFD    QGPQ+++ QF +IL YI +GK+EGA +L
Sbjct: 303 FVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLL 362

Query: 73  TGGKTVGQKGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYGLA 124
            GG     +GY+I+PT+F +V++ M IAK+EIFGPVM ++KF         ANN  YGLA
Sbjct: 363 CGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLA 422

Query: 125 AGIITNDLNTANTVSRSIRAGIIWANCYLAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHV 184
           A + T DL+ AN +S++++AG +W NCY  F    P+GGYKMSG GR+ G   L  Y  V
Sbjct: 423 AAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEV 482

Query: 185 KSVV--TPIHNS 194
           K+V    P  NS
Sbjct: 483 KTVTVKVPQKNS 494


>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query197
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 100.0
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 100.0
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 100.0
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 100.0
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 100.0
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 100.0
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 100.0
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 99.96
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 99.94
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.6
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=100.00  E-value=1.5e-51  Score=361.41  Aligned_cols=192  Identities=51%  Similarity=0.963  Sum_probs=185.8

Q ss_pred             CceeeecCCCEEEEeCccHHHHHHHHHHHHhccccCCCCCCCCcccccCCHHHHHHHHHHHHHHHHcCCEEEeCCceeCC
Q 038769            1 LRVCFTHQFPNIYVQEGIYDEFEKKLVEKAKAWVVGDPFDPAVNQGPQINKKQFDRILSYIESGKKEGATVLTGGKTVGQ   80 (197)
Q Consensus         1 GQ~C~ap~~~rv~V~~~v~d~f~~~l~~~~~~l~vG~p~~~~~~~Gpli~~~~~~~~~~~i~~a~~~Ga~~~~gg~~~~~   80 (197)
                      ||.|++++  |||||++++|+|+++|+++++++++|+|.++++++|||+++.+++++.++|++|+++||++++||...+.
T Consensus       293 GQ~C~a~~--rv~V~~~~~d~f~~~l~~~~~~~~~g~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~Ga~~~~gg~~~~~  370 (494)
T d1bxsa_         293 GQCCIAAS--RLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGN  370 (494)
T ss_dssp             TCCTTCCC--EEEEEHHHHHHHHHHHHHHHTCCCBSCTTSTTCCBCCCSCHHHHHHHHHHHHHHHHTTCEECSCCSEECS
T ss_pred             Ccccccce--EEecccchhHHHHHHHHhhhhheeeeccCCCCCcCCCcCCHHHHHHHHHHHHHHHHcCCEEEeCCCccCC
Confidence            89999966  9999999999999999999999999999999999999999999999999999999999999999987766


Q ss_pred             CCceEecEEEecCCCCCcccccceecceeEEEEEE--------ecCCCCcceeEEeeCChHHHHHHHhhcceeEEEECCC
Q 038769           81 KGYYIEPTIFTNVKEDMLIAKDEIFGPVMVLMKFN--------ANNRRYGLAAGIITNDLNTANTVSRSIRAGIIWANCY  152 (197)
Q Consensus        81 ~g~~~~Ptv~~~~~~~~~~~~eE~FGPvl~v~~~~--------~n~~~~gL~~~v~t~d~~~~~~~~~~l~~G~v~iN~~  152 (197)
                      .|+|++|||+.+++++|.+++||+||||++|++|+        +|+++|||+++|||+|.+++.++++++++|+|+||++
T Consensus       371 ~g~~~~Ptvl~~~~~~~~~~~~E~FGPvl~v~~~~~~~eai~~~n~~~~gL~a~i~t~d~~~~~~~~~~l~~G~v~iN~~  450 (494)
T d1bxsa_         371 KGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCY  450 (494)
T ss_dssp             SSCEECCEEEESCCTTSHHHHSCCCSSEEEEEEECCHHHHHHHHHCSSCCSEEEEECSBHHHHHHHHHHSCCSEEEESCC
T ss_pred             CceeEcCEEEeCCCCCcHHHhccccCceEEEEEECCHHHHHHHHhCCCCCCeEEEEeCCHHHHHHHHHhCCEeEEEEcCC
Confidence            89999999999999999999999999999999998        9999999999999999999999999999999999998


Q ss_pred             CCCCCCCCcCCCCCCCCCCcchHHHHHhcccccEEEEeCCCC
Q 038769          153 LAFDNDCPYGGYKMSGFGRDCGLDSLHKYLHVKSVVTPIHNS  194 (197)
Q Consensus       153 ~~~~~~~pfGG~~~SG~G~~~g~~~~~~f~~~k~v~~~~~~~  194 (197)
                      ....+.+||||+|.||+|+++|.+|+++|++.|+|+++++++
T Consensus       451 ~~~~~~~PfGG~~~SG~G~~~g~~~~~~ft~~k~i~~~~~~~  492 (494)
T d1bxsa_         451 SVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKISQK  492 (494)
T ss_dssp             CCCCTTSCBCCSGGGEESCBSHHHHHHTTEEEEEEEEECSCC
T ss_pred             CCcCCCCCcCccccccCChhhHHHHHHHhcceEEEEEecCCC
Confidence            877789999999999999999999999999999999999764



>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure