Query         038793
Match_columns 251
No_of_seqs    191 out of 495
Neff          4.5 
Searched_HMMs 46136
Date          Fri Mar 29 03:21:28 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038793.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038793hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02362 B3:  B3 DNA binding do  99.7 1.2E-17 2.5E-22  127.7  10.4   83  160-249     1-85  (100)
  2 PF03754 DUF313:  Domain of unk  97.7 8.6E-05 1.9E-09   60.9   6.7   79  156-235    20-114 (114)
  3 PF09217 EcoRII-N:  Restriction  97.6 0.00026 5.7E-09   60.9   7.8   89  156-247     6-110 (156)
  4 KOG0644 Uncharacterized conser  81.6    0.99 2.1E-05   48.3   2.4   64   60-124   872-940 (1113)
  5 PRK03760 hypothetical protein;  68.2      19 0.00041   29.4   6.2   48  199-249    61-117 (117)
  6 PF03120 DNA_ligase_OB:  NAD-de  39.9      23 0.00051   27.6   2.2   19  231-249    43-61  (82)
  7 PF02643 DUF192:  Uncharacteriz  34.9      81  0.0017   25.0   4.6   45  199-246    50-106 (108)
  8 cd06919 Asp_decarbox Aspartate  30.3 3.2E+02  0.0069   22.7   8.2   70  162-247    12-87  (111)
  9 PF12195 End_beta_barrel:  Beta  28.9      31 0.00068   27.0   1.2   16  233-248    23-38  (83)
 10 TIGR01643 YD_repeat_2x YD repe  28.2      79  0.0017   20.2   2.9   21  199-219     6-27  (42)
 11 PF04014 Antitoxin-MazE:  Antid  26.3      90   0.002   21.0   3.1   19  231-249    14-32  (47)
 12 PRK11507 ribosome-associated p  25.6      46 0.00099   25.4   1.6   17  231-247    46-62  (70)
 13 PF13275 S4_2:  S4 domain; PDB:  24.6      33 0.00072   25.6   0.7   18  230-247    41-58  (65)
 14 PF10367 Vps39_2:  Vacuolar sor  24.4      56  0.0012   24.6   2.0   16   65-80     90-105 (109)
 15 COG1430 Uncharacterized conser  24.4 2.5E+02  0.0054   23.6   5.9   77  154-248    27-121 (126)
 16 PF02298 Cu_bind_like:  Plastoc  21.5      48   0.001   25.4   1.0   16  232-247    13-28  (85)
 17 PF14453 ThiS-like:  ThiS-like   21.4      76  0.0016   23.2   2.0   16  234-249    41-56  (57)
 18 PRK05449 aspartate alpha-decar  21.3 5.1E+02   0.011   21.9   8.2   70  162-247    13-88  (126)
 19 PF01878 EVE:  EVE domain;  Int  21.2      61  0.0013   26.4   1.7   14  236-249    38-51  (143)
 20 TIGR00223 panD L-aspartate-alp  21.0 5.2E+02   0.011   21.9   8.2   70  162-247    13-88  (126)
 21 PF02261 Asp_decarbox:  Asparta  20.8   5E+02   0.011   21.7   8.3   70  162-247    13-88  (116)

No 1  
>PF02362 B3:  B3 DNA binding domain;  InterPro: IPR003340 Two DNA binding proteins, RAV1 and RAV2 from Arabidopsis thaliana contain two distinct amino acid sequence domains found only in higher plant species. The N-terminal regions of RAV1 and RAV2 are homologous to the AP2 DNA-binding domain (see IPR001471 from INTERPRO) present in a family of transcription factors, while the C-terminal region exhibits homology to the highly conserved C-terminal domain, designated B3, of VP1/ABI3 transcription factors []. The AP2 and B3-like domains of RAV1 bind autonomously to the CAACA and CACCTG motifs, respectively, and together achieve a high affinity and specificity of binding. It has been suggested that the AP2 and B3-like domains of RAV1 are connected by a highly flexible structure enabling the two domains to bind to the CAACA and CACCTG motifs in various spacings and orientations [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1WID_A 1YEL_A.
Probab=99.74  E-value=1.2e-17  Score=127.68  Aligned_cols=83  Identities=34%  Similarity=0.483  Sum_probs=65.9

Q ss_pred             EEEecccCCCCCCC-EEEehhhhhhhCCCCccccccCCCCeEEEEEeCCCCeEEEEE-EeCCCCceEEcccHHHHhhhcC
Q 038793          160 FYKKLRASDQSKKK-IVIRAKDAENVFPFLAHLDYKKQINYSVIAKDVHGVAWKFNF-VDGKSRRHYLTVGWKYFVRQKN  237 (251)
Q Consensus       160 F~K~LT~SDv~~~g-lsVPk~~Ae~~FP~l~~Ld~~~~~p~~L~~~D~~G~~W~Fr~-yr~~srrhlLTtGWs~FVr~K~  237 (251)
                      |.|+|++||+.+.+ |.||+++++.+...     .  ..++.+.+.|..|+.|.+++ +++.+++++|++||..||++++
T Consensus         1 F~K~l~~s~~~~~~~l~iP~~f~~~~~~~-----~--~~~~~v~l~~~~g~~W~v~~~~~~~~~~~~l~~GW~~Fv~~n~   73 (100)
T PF02362_consen    1 FFKVLKPSDVSSSCRLIIPKEFAKKHGGN-----K--RKSREVTLKDPDGRSWPVKLKYRKNSGRYYLTGGWKKFVRDNG   73 (100)
T ss_dssp             EEEE--TTCCCCTT-EEE-HHHHTTTS-------S--S--CEEEEEETTTEEEEEEEEEECCTTEEEEETTHHHHHHHCT
T ss_pred             CEEEEEccCcCCCCEEEeCHHHHHHhCCC-----c--CCCeEEEEEeCCCCEEEEEEEEEccCCeEEECCCHHHHHHHcC
Confidence            89999999999877 99999999987311     1  11268999999999999999 8988888999999999999999


Q ss_pred             CCCCCEEEEEec
Q 038793          238 LVPGDTVIFIRY  249 (251)
Q Consensus       238 L~aGD~VvF~R~  249 (251)
                      |++||.|+|+..
T Consensus        74 L~~GD~~~F~~~   85 (100)
T PF02362_consen   74 LKEGDVCVFELI   85 (100)
T ss_dssp             --TT-EEEEEE-
T ss_pred             CCCCCEEEEEEe
Confidence            999999999853


No 2  
>PF03754 DUF313:  Domain of unknown function (DUF313) ;  InterPro: IPR005508 This is a family of proteins from Arabidopsis thaliana (Mouse-ear cress) with uncharacterised function.
Probab=97.75  E-value=8.6e-05  Score=60.86  Aligned_cols=79  Identities=18%  Similarity=0.254  Sum_probs=57.7

Q ss_pred             CCCeEEEecccCCCCCCC--EEEehhhhhhhCCCCcc-----c----cc-cCCCCeEEEEEeCCCCeEEEEE-EeCC---
Q 038793          156 TPPLFYKKLRASDQSKKK--IVIRAKDAENVFPFLAH-----L----DY-KKQINYSVIAKDVHGVAWKFNF-VDGK---  219 (251)
Q Consensus       156 ~~~~F~K~LT~SDv~~~g--lsVPk~~Ae~~FP~l~~-----L----d~-~~~~p~~L~~~D~~G~~W~Fr~-yr~~---  219 (251)
                      ....|.|+|++||+..+-  |+||-..-.. ..+|..     +    .. .....+.+.+.|..++.|..++ .|..   
T Consensus        20 ~kli~~K~L~~tDv~~~qsRLsmP~~qi~~-~dFLt~eE~~~i~~~~~~~~~~~Gv~V~lvdp~~~~~~m~lkkW~mg~~   98 (114)
T PF03754_consen   20 PKLIIEKTLFKTDVDPHQSRLSMPFNQIID-NDFLTEEEKRIIKEEKKNNDKKKGVEVILVDPSLRKWTMRLKKWNMGNG   98 (114)
T ss_pred             CeEEEeeeecccCCCCCCceeeccHHHhcc-cccCCHHHHHHHHHhhccCcccCCceEEEECCcCcEEEEEEEEecccCC
Confidence            457899999999998764  9999875532 233110     1    00 1122288999999999999999 8866   


Q ss_pred             CCceEEcccHHHHhhh
Q 038793          220 SRRHYLTVGWKYFVRQ  235 (251)
Q Consensus       220 srrhlLTtGWs~FVr~  235 (251)
                      ...|+|.+||..+|.+
T Consensus        99 ~~~YvL~~gWn~VV~~  114 (114)
T PF03754_consen   99 TSNYVLNSGWNKVVED  114 (114)
T ss_pred             ceEEEEEcChHhhccC
Confidence            4579999999999863


No 3  
>PF09217 EcoRII-N:  Restriction endonuclease EcoRII, N-terminal;  InterPro: IPR023372 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].  This entry represents the N-terminal effector-binding domain of the type II restriction endonuclease EcoRII, which has a DNA recognition fold, allowing for binding to 5'-CCWGG sequences. It assumes a structure composed of an eight-stranded beta-sheet with the strands in the order of b2, b5, b4, b3, b7, b6, b1 and b8. They are mostly antiparallel to each other except that b3 is parallel to b7. Alternatively, it may also be viewed as consisting of two mini beta-sheets of four antiparallel beta-strands, sheet I from beta-strands b2, b5, b4, b3 and sheet II from strands b7, b6, b1, b8, folded into an open mixed beta-barrel with a novel topology. Sheet I has a simple Greek key motif while sheet II does not [].  The domain represented by this entry is only found in bacterial proteins.; PDB: 3HQF_A 1NA6_A.
Probab=97.60  E-value=0.00026  Score=60.91  Aligned_cols=89  Identities=18%  Similarity=0.173  Sum_probs=52.7

Q ss_pred             CCCeEEEecccCCCCCCC-----EEEehhhhhhhCCCCccccccCCCC-eEEEEEeCCC--CeEEEEE-EeCC------C
Q 038793          156 TPPLFYKKLRASDQSKKK-----IVIRAKDAENVFPFLAHLDYKKQIN-YSVIAKDVHG--VAWKFNF-VDGK------S  220 (251)
Q Consensus       156 ~~~~F~K~LT~SDv~~~g-----lsVPk~~Ae~~FP~l~~Ld~~~~~p-~~L~~~D~~G--~~W~Fr~-yr~~------s  220 (251)
                      ....|+|.|++.|++..|     +.||+..++..||.+.  ..+..+| ..|.+++..|  ..|+||+ |.|+      .
T Consensus         6 ~~~~~~K~LSaNDtGaTGgHQaGiyIpk~~~~~lFp~~~--~~~~~Np~~~~~~~~~s~~~~~~~~r~iYYnn~~~~gTR   83 (156)
T PF09217_consen    6 SWAIYCKRLSANDTGATGGHQAGIYIPKSAAELLFPSIN--HTKEENPDIWLKARWQSHFVTDSQVRFIYYNNRLFGGTR   83 (156)
T ss_dssp             SEEEEEEE--CCCCTTTSSS--EEEE-HHHHHHH-GGG---SSSSSS-EEEEEEEETTTT---EEEEEEEE-CCCTTSS-
T ss_pred             ceEEEEEEccCCCCCCcCcccceeEecccHHHHhCCCCC--cccccCCceeEEEEECCCCccceeEEEEEEcccccCCCc
Confidence            345799999999996643     9999999999999843  2355677 9999999988  5687888 6655      2


Q ss_pred             CceEEcccHHHHhh-hcCCCCCCEEEEE
Q 038793          221 RRHYLTVGWKYFVR-QKNLVPGDTVIFI  247 (251)
Q Consensus       221 rrhlLTtGWs~FVr-~K~L~aGD~VvF~  247 (251)
                      +-+-|| +|...-. .+-=..||-+||.
T Consensus        84 NE~RIT-~~G~~~~~~~~~~tGaL~vla  110 (156)
T PF09217_consen   84 NEYRIT-RFGRGFPLQNPENTGALLVLA  110 (156)
T ss_dssp             -EEEEE----TTSGGG-GGGTT-EEEEE
T ss_pred             CceEEe-eecCCCccCCccccccEEEEE
Confidence            335665 3332222 2222478888886


No 4  
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]
Probab=81.60  E-value=0.99  Score=48.35  Aligned_cols=64  Identities=28%  Similarity=0.472  Sum_probs=43.8

Q ss_pred             CCCCCCCeEEEecCCccccccCCCCCCCCCCC-----CCCCcceEEEEEEEEeecCCcCceeEEEEEeec
Q 038793           60 SLPKKGDLVVYFPQGHLEYSAPASVSKAPPTF-----DLKPEIICRVADVRYLVSKKTDKVYTKMTLLPL  124 (251)
Q Consensus        60 ~lP~~gs~V~YFPqGH~Eq~~~s~~~~~~p~~-----~lp~~i~C~V~~V~l~Ad~~TDEVyA~i~L~P~  124 (251)
                      -||..|+.|.||-|||-|.+.+..-. .++.-     ++-..=.|.|..+..--=+-...---+|.|.=.
T Consensus       872 yipQmgDEViyfrQghqeyl~~~~~n-~~~~~~~~p~~~~~v~~~kv~kl~~~~y~~~~~s~c~m~l~~i  940 (1113)
T KOG0644|consen  872 YIPQMGDEVIYFRQGHQEYLEAVRLN-NIELNNKEPWNKMAVEICKVEKLVYITYPGSGDSCCKMKLAVI  940 (1113)
T ss_pred             ccccccceeehhhhhhHHHHhhhhhc-cccccccCcccccchhhheeeeeeeeeccCCCcchheeeeeee
Confidence            68999999999999999999986421 12211     232334688888877666666666666666544


No 5  
>PRK03760 hypothetical protein; Provisional
Probab=68.15  E-value=19  Score=29.44  Aligned_cols=48  Identities=25%  Similarity=0.264  Sum_probs=31.6

Q ss_pred             eEEEEEeCCCCeEEEEE---Ee----CCCCceEE--cccHHHHhhhcCCCCCCEEEEEec
Q 038793          199 YSVIAKDVHGVAWKFNF---VD----GKSRRHYL--TVGWKYFVRQKNLVPGDTVIFIRY  249 (251)
Q Consensus       199 ~~L~~~D~~G~~W~Fr~---yr----~~srrhlL--TtGWs~FVr~K~L~aGD~VvF~R~  249 (251)
                      ..+.+.|.+|++=....   ++    ..+-+|+|  ..||   +.+.++++||.|.|.|+
T Consensus        61 LDiiFld~~g~Vv~i~~~~P~~~~~~~~~a~~VLEl~aG~---~~~~gi~~Gd~v~~~~~  117 (117)
T PRK03760         61 IDVIFLDSNRRVVDFKTLKPWRIYVPKKPARYIIEGPVGK---IRVLKVEVGDEIEWIDE  117 (117)
T ss_pred             eEEEEECCCCeEEEEEeCCCccccCCCccceEEEEeCCCh---HHHcCCCCCCEEEEeeC
Confidence            45666676666444322   11    22345777  6775   67899999999999874


No 6  
>PF03120 DNA_ligase_OB:  NAD-dependent DNA ligase OB-fold domain;  InterPro: IPR004150 DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This family is a small domain found after the adenylation domain DNA_ligase_N in NAD+-dependent ligases (IPR001679 from INTERPRO). OB-fold domains generally are involved in nucleic acid binding.; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 2OWO_A 1TAE_A 3UQ8_A 1DGS_A 1V9P_B 3SGI_A.
Probab=39.92  E-value=23  Score=27.55  Aligned_cols=19  Identities=26%  Similarity=0.529  Sum_probs=15.7

Q ss_pred             HHhhhcCCCCCCEEEEEec
Q 038793          231 YFVRQKNLVPGDTVIFIRY  249 (251)
Q Consensus       231 ~FVr~K~L~aGD~VvF~R~  249 (251)
                      .|+++++|..||.|.++|.
T Consensus        43 ~~i~~~~i~~Gd~V~V~ra   61 (82)
T PF03120_consen   43 DYIKELDIRIGDTVLVTRA   61 (82)
T ss_dssp             HHHHHTT-BBT-EEEEEEE
T ss_pred             HHHHHcCCCCCCEEEEEEC
Confidence            7899999999999999985


No 7  
>PF02643 DUF192:  Uncharacterized ACR, COG1430;  InterPro: IPR003795 This entry describes proteins of unknown function.; PDB: 3M7A_B 3PJY_B.
Probab=34.95  E-value=81  Score=25.04  Aligned_cols=45  Identities=24%  Similarity=0.298  Sum_probs=27.7

Q ss_pred             eEEEEEeCCCCeEEEEE-E---eC------CCCceEE--cccHHHHhhhcCCCCCCEEEE
Q 038793          199 YSVIAKDVHGVAWKFNF-V---DG------KSRRHYL--TVGWKYFVRQKNLVPGDTVIF  246 (251)
Q Consensus       199 ~~L~~~D~~G~~W~Fr~-y---r~------~srrhlL--TtGWs~FVr~K~L~aGD~VvF  246 (251)
                      ..+.+.|..|++=.... .   +.      ++-+|+|  ..|   ++.+.+|++||.|.|
T Consensus        50 LDi~fld~~g~Vv~i~~~~~P~~~~~~~~~~~a~~vLE~~aG---~~~~~~i~~Gd~v~~  106 (108)
T PF02643_consen   50 LDIAFLDSDGRVVKIERMVPPWRTYPCPSYKPARYVLELPAG---WFEKLGIKVGDRVRI  106 (108)
T ss_dssp             EEEEEE-TTSBEEEEEEEE-TT--S-EEECCEECEEEEEETT---HHHHHT--TT-EEE-
T ss_pred             EEEEEECCCCeEEEEEccCCCCccCCCCCCCccCEEEEcCCC---chhhcCCCCCCEEEe
Confidence            67888898888666655 3   11      1236787  455   578999999999987


No 8  
>cd06919 Asp_decarbox Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent  decarboxylase in beta-alanine production. Decarboxylation of aspartate is  the major route of beta-alanine production in bacteria, and is catalyzed  by the enzyme L-aspartate decarboxylase (ADC), EC:4.1.1.11 which  requires a pyruvoyl group for its activity. The pyruvoyl cofactor is  covalently bound to the enzyme. The protein is synthesized as a  proenzyme and cleaved via self-processing at Gly23-Ser24 to yield an  alpha chain (C-terminal fragment) and beta chain (N-terminal fragment),  and the pyruvoyl group. Beta-alanine is required for the biosynthesis of  pantothenate, in which the enzyme plays a critical regulatory role. The  active site of the tetrameric enzyme is located at the interface of two  subunits, with a Lysine and a Histidine from the beta chain of one  subunit forming the active site with residues from the alpha chain of  the adjacent subunit. This alignment 
Probab=30.30  E-value=3.2e+02  Score=22.69  Aligned_cols=70  Identities=23%  Similarity=0.365  Sum_probs=49.3

Q ss_pred             EecccCCCCCCC-EEEehhhhh--hhCCCCccccccCCCCeEEEEEeC-CCCeEEEEEEeCC--CCceEEcccHHHHhhh
Q 038793          162 KKLRASDQSKKK-IVIRAKDAE--NVFPFLAHLDYKKQINYSVIAKDV-HGVAWKFNFVDGK--SRRHYLTVGWKYFVRQ  235 (251)
Q Consensus       162 K~LT~SDv~~~g-lsVPk~~Ae--~~FP~l~~Ld~~~~~p~~L~~~D~-~G~~W~Fr~yr~~--srrhlLTtGWs~FVr~  235 (251)
                      -+.|..|..-.| +.|...-.+  .++|.           ..+.+.|. +|..|.=--..+.  |+.-.|.+.     -+
T Consensus        12 atVT~a~L~YeGSitID~~Ll~aagi~~~-----------E~V~I~Nv~NG~Rf~TYvI~g~~gSg~I~lNGA-----AA   75 (111)
T cd06919          12 ATVTEADLNYEGSITIDEDLLEAAGILPY-----------EKVLVVNVNNGARFETYVIPGERGSGVICLNGA-----AA   75 (111)
T ss_pred             eEEeccccccceeEEECHHHHHhcCCCCC-----------CEEEEEECCCCcEEEEEEEEcCCCCCEEEeCCH-----HH
Confidence            468899998889 999887544  34444           45777787 6887764336655  344566554     57


Q ss_pred             cCCCCCCEEEEE
Q 038793          236 KNLVPGDTVIFI  247 (251)
Q Consensus       236 K~L~aGD~VvF~  247 (251)
                      +.-..||.||++
T Consensus        76 r~~~~GD~vII~   87 (111)
T cd06919          76 RLGQPGDRVIIM   87 (111)
T ss_pred             hcCCCCCEEEEE
Confidence            788999999986


No 9  
>PF12195 End_beta_barrel:  Beta barrel domain of bacteriophage endosialidase;  InterPro: IPR024427 This entry represents the beta barrel domain of endosialidases which is nested in a beta propeller domain. This beta barrel domain is approximately 80 amino acids in length and represents one of the two sialic acid binding sites of the enzyme [].; PDB: 1V0E_B 1V0F_E 3JU4_A 3GVL_A 3GVK_B 3GVJ_A.
Probab=28.86  E-value=31  Score=27.04  Aligned_cols=16  Identities=31%  Similarity=0.439  Sum_probs=8.4

Q ss_pred             hhhcCCCCCCEEEEEe
Q 038793          233 VRQKNLVPGDTVIFIR  248 (251)
Q Consensus       233 Vr~K~L~aGD~VvF~R  248 (251)
                      +-+++|.+||.|.|.-
T Consensus        23 l~~HGl~vGD~VnFsn   38 (83)
T PF12195_consen   23 LTDHGLFVGDFVNFSN   38 (83)
T ss_dssp             -TT----TT-EEEEES
T ss_pred             EccCceeecceEEEec
Confidence            4579999999999964


No 10 
>TIGR01643 YD_repeat_2x YD repeat (two copies). This model describes two tandem copies of a 21-residue extracellular repeat found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin.
Probab=28.16  E-value=79  Score=20.16  Aligned_cols=21  Identities=14%  Similarity=0.385  Sum_probs=17.1

Q ss_pred             eEEEEEeCCCCeEEEEE-EeCC
Q 038793          199 YSVIAKDVHGVAWKFNF-VDGK  219 (251)
Q Consensus       199 ~~L~~~D~~G~~W~Fr~-yr~~  219 (251)
                      +.+.+.|..|..|+|.| -.|+
T Consensus         6 ~l~~~~~p~G~~~~~~YD~~Gr   27 (42)
T TIGR01643         6 RLTGSTDADGTTTRYTYDAAGR   27 (42)
T ss_pred             CEEEEECCCCCEEEEEECCCCC
Confidence            56788899999999999 5543


No 11 
>PF04014 Antitoxin-MazE:  Antidote-toxin recognition MazE;  InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation []. AbrB is thought to interact directly with the transcription initiation regions of genes under its control []. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins []. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator []. DNA-binding activity in this AbrB homologue requires hexamerisation []. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins [].; PDB: 2L66_A 2GLW_A 3TND_D 2W1T_B 2RO5_B 2FY9_A 2RO3_B 1UB4_C 3ZVK_G 1YFB_B ....
Probab=26.28  E-value=90  Score=20.96  Aligned_cols=19  Identities=26%  Similarity=0.211  Sum_probs=15.7

Q ss_pred             HHhhhcCCCCCCEEEEEec
Q 038793          231 YFVRQKNLVPGDTVIFIRY  249 (251)
Q Consensus       231 ~FVr~K~L~aGD~VvF~R~  249 (251)
                      .|.++.+|.+||.|.|.-.
T Consensus        14 ~~~~~l~l~~Gd~v~i~~~   32 (47)
T PF04014_consen   14 EIREKLGLKPGDEVEIEVE   32 (47)
T ss_dssp             HHHHHTTSSTTTEEEEEEE
T ss_pred             HHHHHcCCCCCCEEEEEEe
Confidence            5678889999999998643


No 12 
>PRK11507 ribosome-associated protein; Provisional
Probab=25.60  E-value=46  Score=25.37  Aligned_cols=17  Identities=29%  Similarity=0.386  Sum_probs=14.1

Q ss_pred             HHhhhcCCCCCCEEEEE
Q 038793          231 YFVRQKNLVPGDTVIFI  247 (251)
Q Consensus       231 ~FVr~K~L~aGD~VvF~  247 (251)
                      ..-|.|+|+.||.|.|-
T Consensus        46 e~rRgkKl~~GD~V~~~   62 (70)
T PRK11507         46 ETRKRCKIVAGQTVSFA   62 (70)
T ss_pred             ecccCCCCCCCCEEEEC
Confidence            45577999999999984


No 13 
>PF13275 S4_2:  S4 domain; PDB: 1P9K_A.
Probab=24.63  E-value=33  Score=25.60  Aligned_cols=18  Identities=39%  Similarity=0.333  Sum_probs=8.6

Q ss_pred             HHHhhhcCCCCCCEEEEE
Q 038793          230 KYFVRQKNLVPGDTVIFI  247 (251)
Q Consensus       230 s~FVr~K~L~aGD~VvF~  247 (251)
                      ...-|.++|++||.|.|-
T Consensus        41 ~e~rrg~Kl~~GD~V~~~   58 (65)
T PF13275_consen   41 VETRRGKKLRPGDVVEID   58 (65)
T ss_dssp             ----SS----SSEEEEET
T ss_pred             EccccCCcCCCCCEEEEC
Confidence            455678999999999983


No 14 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=24.45  E-value=56  Score=24.60  Aligned_cols=16  Identities=31%  Similarity=0.559  Sum_probs=13.2

Q ss_pred             CCeEEEecCCcccccc
Q 038793           65 GDLVVYFPQGHLEYSA   80 (251)
Q Consensus        65 gs~V~YFPqGH~Eq~~   80 (251)
                      ++.+++||.||+-|..
T Consensus        90 ~~~f~~~p~~~v~H~~  105 (109)
T PF10367_consen   90 NSVFVVFPCGHVVHYS  105 (109)
T ss_pred             CceEEEeCCCeEEecc
Confidence            4789999999998754


No 15 
>COG1430 Uncharacterized conserved protein [Function unknown]
Probab=24.38  E-value=2.5e+02  Score=23.58  Aligned_cols=77  Identities=18%  Similarity=0.230  Sum_probs=47.5

Q ss_pred             CCCCCeEEEecccCCCCCCC--EEEehhhhh-----hhCCCCccccccCCCCeEEEEEeCCCC-eEEEEE--Ee----CC
Q 038793          154 NSTPPLFYKKLRASDQSKKK--IVIRAKDAE-----NVFPFLAHLDYKKQINYSVIAKDVHGV-AWKFNF--VD----GK  219 (251)
Q Consensus       154 ~~~~~~F~K~LT~SDv~~~g--lsVPk~~Ae-----~~FP~l~~Ld~~~~~p~~L~~~D~~G~-~W~Fr~--yr----~~  219 (251)
                      +..-.+|.+.|    ...+|  |..|+ -..     +.++.          |.+|.+.|..|+ +|.-.-  ++    .+
T Consensus        27 r~~GLMfR~sl----~~d~GMLFv~~~-~~~~~~wMknt~l----------pLDiiFid~dg~i~~i~~~~P~~~~~~~~   91 (126)
T COG1430          27 RARGLMFRTSL----PDDHGMLFVFPE-TRRVAFWMKNTML----------PLDIIFIDSDGRVVDIVELVPWSTYPCKS   91 (126)
T ss_pred             HhccccccccC----CCCceEEEecCC-CceeEEeeecCCc----------ceEEEEEcCCCCEEEEEeccccccCCCCC
Confidence            55667888887    33457  66662 211     22232          257888888887 344332  22    11


Q ss_pred             --CCceEE--cccHHHHhhhcCCCCCCEEEEEe
Q 038793          220 --SRRHYL--TVGWKYFVRQKNLVPGDTVIFIR  248 (251)
Q Consensus       220 --srrhlL--TtGWs~FVr~K~L~aGD~VvF~R  248 (251)
                        +.+|+|  ..||   ++.+++++||.|.|..
T Consensus        92 ~~~~~yvLEl~~G~---~~~~~i~vGd~v~~~~  121 (126)
T COG1430          92 YGPVRYVLELPAGW---AARLGIKVGDRVEFRP  121 (126)
T ss_pred             CCCccEEEEecCCc---hhhcCCccCCEEEecc
Confidence              224777  5776   6789999999999864


No 16 
>PF02298 Cu_bind_like:  Plastocyanin-like domain;  InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ]. The most well known members of this class of proteins are the plant chloroplastic plastocyanins, which exchange electrons with cytochrome c6, and the distantly related bacterial azurins, which exchange electrons with cytochrome c551. This family of proteins also includes amicyanin from bacteria such as Methylobacterium extorquens or Paracoccus versutus (Thiobacillus versutus) that can grow on methylamine; auracyanins A and B from Chloroflexus aurantiacus []; blue copper protein from Alcaligenes faecalis; cupredoxin (CPC) from Cucumis sativus (Cucumber) peelings []; cusacyanin (basic blue protein; plantacyanin, CBP) from cucumber; halocyanin from Natronomonas pharaonis (Natronobacterium pharaonis) [], a membrane associated copper-binding protein; pseudoazurin from Pseudomonas; rusticyanin from Thiobacillus ferrooxidans []; stellacyanin from Rhus vernicifera (Japanese lacquer tree); umecyanin from the roots of Armoracia rusticana (Horseradish); and allergen Ra3 from ragweed. Although there is an appreciable amount of divergence in the sequences of all these proteins, the copper ligand sites are conserved. This domain is found in a variety of plant cyanins and pollern allergen. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Amb a 3.; GO: 0005507 copper ion binding, 0009055 electron carrier activity; PDB: 1JER_A 1WS7_A 1WS8_D 1F56_B 1X9R_B 1X9U_A 2CBP_A.
Probab=21.50  E-value=48  Score=25.37  Aligned_cols=16  Identities=31%  Similarity=0.569  Sum_probs=12.7

Q ss_pred             HhhhcCCCCCCEEEEE
Q 038793          232 FVRQKNLVPGDTVIFI  247 (251)
Q Consensus       232 FVr~K~L~aGD~VvF~  247 (251)
                      -...|.+++||+++|.
T Consensus        13 Wa~~~~F~vGD~LvF~   28 (85)
T PF02298_consen   13 WASGKTFRVGDTLVFN   28 (85)
T ss_dssp             HHCTS-BETTEEEEEE
T ss_pred             hhcCCcEeCCCEEEEE
Confidence            3578999999999994


No 17 
>PF14453 ThiS-like:  ThiS-like ubiquitin 
Probab=21.38  E-value=76  Score=23.24  Aligned_cols=16  Identities=31%  Similarity=0.503  Sum_probs=13.7

Q ss_pred             hhcCCCCCCEEEEEec
Q 038793          234 RQKNLVPGDTVIFIRY  249 (251)
Q Consensus       234 r~K~L~aGD~VvF~R~  249 (251)
                      .+..|+.||.|+|.|.
T Consensus        41 ~d~~L~e~D~v~~Ikk   56 (57)
T PF14453_consen   41 EDIELKEGDEVFLIKK   56 (57)
T ss_pred             CccccCCCCEEEEEeC
Confidence            4678999999999875


No 18 
>PRK05449 aspartate alpha-decarboxylase; Provisional
Probab=21.29  E-value=5.1e+02  Score=21.94  Aligned_cols=70  Identities=19%  Similarity=0.223  Sum_probs=49.1

Q ss_pred             EecccCCCCCCC-EEEehhhhh--hhCCCCccccccCCCCeEEEEEeC-CCCeEEEEEEeCC--CCceEEcccHHHHhhh
Q 038793          162 KKLRASDQSKKK-IVIRAKDAE--NVFPFLAHLDYKKQINYSVIAKDV-HGVAWKFNFVDGK--SRRHYLTVGWKYFVRQ  235 (251)
Q Consensus       162 K~LT~SDv~~~g-lsVPk~~Ae--~~FP~l~~Ld~~~~~p~~L~~~D~-~G~~W~Fr~yr~~--srrhlLTtGWs~FVr~  235 (251)
                      -+.|..|..-.| +.|-..-.+  .++|.           ..+.+.|. +|..|.=--..+.  |+.-.|++.     -+
T Consensus        13 atVT~a~L~Y~GSitID~~Ll~aagi~p~-----------E~V~V~Nv~NG~Rf~TYvI~g~~GSg~I~lNGA-----AA   76 (126)
T PRK05449         13 ATVTEADLNYEGSITIDEDLLDAAGILEN-----------EKVQIVNVNNGARFETYVIAGERGSGVICLNGA-----AA   76 (126)
T ss_pred             eEEeccccccceeEEECHHHHHhcCCCCC-----------CEEEEEECCCCcEEEEEEEEcCCCCCEEEeCCH-----HH
Confidence            468899998889 999887544  45554           35777786 6887764335655  344556554     57


Q ss_pred             cCCCCCCEEEEE
Q 038793          236 KNLVPGDTVIFI  247 (251)
Q Consensus       236 K~L~aGD~VvF~  247 (251)
                      +.-..||.||++
T Consensus        77 r~~~~GD~vII~   88 (126)
T PRK05449         77 RLVQVGDLVIIA   88 (126)
T ss_pred             hcCCCCCEEEEE
Confidence            788999999986


No 19 
>PF01878 EVE:  EVE domain;  InterPro: IPR002740 The EVE domain is part of the wider PUA domain superfamily. The function of this domain is not known but, given the structural similarities to PUA, is likely to involve RNA binding []. ; PDB: 2G2X_B 2AR1_A 3EOP_A 2EVE_A 2HD9_A 2ZBN_A 1WMM_A 2P5D_A 2GBS_A 1ZCE_A.
Probab=21.22  E-value=61  Score=26.38  Aligned_cols=14  Identities=50%  Similarity=0.857  Sum_probs=9.6

Q ss_pred             cCCCCCCEEEEEec
Q 038793          236 KNLVPGDTVIFIRY  249 (251)
Q Consensus       236 K~L~aGD~VvF~R~  249 (251)
                      ++++.||.|+||..
T Consensus        38 ~~mk~GD~vifY~s   51 (143)
T PF01878_consen   38 KRMKPGDKVIFYHS   51 (143)
T ss_dssp             HC--TT-EEEEEET
T ss_pred             hcCCCCCEEEEEEc
Confidence            39999999999975


No 20 
>TIGR00223 panD L-aspartate-alpha-decarboxylase. Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group.
Probab=20.97  E-value=5.2e+02  Score=21.92  Aligned_cols=70  Identities=19%  Similarity=0.209  Sum_probs=48.9

Q ss_pred             EecccCCCCCCC-EEEehhhhh--hhCCCCccccccCCCCeEEEEEeC-CCCeEEEEEEeCC--CCceEEcccHHHHhhh
Q 038793          162 KKLRASDQSKKK-IVIRAKDAE--NVFPFLAHLDYKKQINYSVIAKDV-HGVAWKFNFVDGK--SRRHYLTVGWKYFVRQ  235 (251)
Q Consensus       162 K~LT~SDv~~~g-lsVPk~~Ae--~~FP~l~~Ld~~~~~p~~L~~~D~-~G~~W~Fr~yr~~--srrhlLTtGWs~FVr~  235 (251)
                      -+.|..|..-.| +.|-..-.+  .++|.           ..+.+.|. +|..|+=--..|.  |+.-.|.+.     -+
T Consensus        13 atVT~a~L~Y~GSItID~~Lm~aagi~p~-----------E~V~V~Nv~NG~Rf~TYvI~G~~GSg~I~lNGA-----AA   76 (126)
T TIGR00223        13 ATVTHANLNYEGSITIDEDLLDAAGILEN-----------EKVDIVNVNNGKRFSTYAIAGKRGSRIICVNGA-----AA   76 (126)
T ss_pred             eEEeccccccceeEEECHHHHHhcCCCCC-----------CEEEEEECCCCcEEEEEEEEcCCCCCEEEeCCH-----HH
Confidence            467889998889 999887544  34554           35777786 6888764335655  344556554     57


Q ss_pred             cCCCCCCEEEEE
Q 038793          236 KNLVPGDTVIFI  247 (251)
Q Consensus       236 K~L~aGD~VvF~  247 (251)
                      +.-..||.||++
T Consensus        77 rl~~~GD~VII~   88 (126)
T TIGR00223        77 RCVSVGDIVIIA   88 (126)
T ss_pred             hcCCCCCEEEEE
Confidence            788999999986


No 21 
>PF02261 Asp_decarbox:  Aspartate decarboxylase;  InterPro: IPR003190 Decarboxylation of aspartate is the major route of alanine production in bacteria, and is catalysed by the enzyme aspartate decarboxylase. The enzyme is translated as an inactive proenzyme of two chains, A and B. This family contains both chains of aspartate decarboxylase.; GO: 0004068 aspartate 1-decarboxylase activity, 0006523 alanine biosynthetic process; PDB: 1PYU_C 1AW8_A 1PYQ_B 3TM7_C 1PT1_A 1PQH_A 1PPY_B 1PT0_B 1PQF_A 1PQE_A ....
Probab=20.82  E-value=5e+02  Score=21.69  Aligned_cols=70  Identities=20%  Similarity=0.314  Sum_probs=42.6

Q ss_pred             EecccCCCCCCC-EEEehhhhh--hhCCCCccccccCCCCeEEEEEeC-CCCeEEEEEEeCC--CCceEEcccHHHHhhh
Q 038793          162 KKLRASDQSKKK-IVIRAKDAE--NVFPFLAHLDYKKQINYSVIAKDV-HGVAWKFNFVDGK--SRRHYLTVGWKYFVRQ  235 (251)
Q Consensus       162 K~LT~SDv~~~g-lsVPk~~Ae--~~FP~l~~Ld~~~~~p~~L~~~D~-~G~~W~Fr~yr~~--srrhlLTtGWs~FVr~  235 (251)
                      -+.|..|..-.| +.|...-.+  .++|.           -.+.+.+. +|..|.=--..+.  |+.--|.+.     -+
T Consensus        13 atVT~a~L~Y~GSitID~~Ll~aagi~p~-----------E~V~V~Nv~nG~Rf~TYvI~g~~GSg~I~lNGa-----AA   76 (116)
T PF02261_consen   13 ATVTEADLNYEGSITIDEDLLDAAGILPY-----------EQVQVVNVNNGERFETYVIPGERGSGVICLNGA-----AA   76 (116)
T ss_dssp             EE--EEETTSTSCEEEEHHHHHHCT--TT-----------BEEEEEETTT--EEEEEEEEESTTTT-EEEEGG-----GG
T ss_pred             eEEeccccccceeeEECHHHHHHcCCCcC-----------CEEEEEECCCCcEEEEEEEEccCCCcEEEECCH-----HH
Confidence            367889998889 999987544  45554           35777786 6888874335544  344566554     67


Q ss_pred             cCCCCCCEEEEE
Q 038793          236 KNLVPGDTVIFI  247 (251)
Q Consensus       236 K~L~aGD~VvF~  247 (251)
                      +.-++||.||++
T Consensus        77 rl~~~GD~vII~   88 (116)
T PF02261_consen   77 RLVQVGDRVIIM   88 (116)
T ss_dssp             GCS-TT-EEEEE
T ss_pred             hccCCCCEEEEE
Confidence            788999999986


Done!