Citrus Sinensis ID: 038810

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----

MGAGREVAISLDGVRDKNLMQLKKLNIALFPVRYNDKYYSDALASGEFTKLAYYSDICVGAIACRLEKKEGGAICVYIMTLGVLAPYRGLGIGTKLLNHVLDLCAKQNISEVYLHVQTNNEDAINFYKKFGFDITDTIKNYYTNITPPDCYVLTKFITQPQPKN

cccccEEEEEEEccccccHHHHHHHHHHcccccccHHHHHHHHHccccEEEEEEccEEEEEEEEEEEEcccccEEEEEEEEECccccccccHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccEEcEEcccccccccccEEEEEEEcccccccc

******V*ISLDGVRDKNLMQLKKLNIALFPVRYNDKYYSDALASGEFTKLAYYSDICVGAIACRLEKKEGGAICVYIMTLGVLAPYRGLGIGTKLLNHVLDLCAKQNISEVYLHVQTNNEDAINFYKKFGFDITDTIKNYYTNITPPDCYVLTKFIT******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGAGREVAISLDGVRDKNLMQLKKLNIALFPVRYNDKYYSDALASGEFTKLAYYSDICVGAIACRLEKKEGGAICVYIMTLGVLAPYRGLGIGTKLLNHVLDLCAKQNISEVYLHVQTNNEDAINFYKKFGFDITDTIKNYYTNITPPDCYVLTKFITQPQPKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
N-alpha-acetyltransferase 50	Probable alpha (N-terminal) acetyltransferase.	probable	Q5XGA9
N-alpha-acetyltransferase 50	Probable alpha (N-terminal) acetyltransferase essential in embryonic cell proliferation and survival.	probable	Q6DBY2
N-alpha-acetyltransferase 50	Probable catalytic component of the NAA11-NAA15 complex which displays alpha (N-terminal) acetyltransferase activity.	probable	Q0IIJ0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OB0, chain A
Confidence level:very confident
Coverage over the Query: 7-157
View the alignment between query and template
View the model in PyMOL