Citrus Sinensis ID: 038814

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPYIVNLTSD
cHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccEEEEccccEEEEccHHHHHHHHccccccccccccccHHHHccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHHcccc
cHHHHHHHHHHHHcHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccEEEEEccccEEEEccHHHHHHHHHHccccccccccHHHHHHHccccccccHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHccc
VTWAWKILNWAWLKPKRVEKQLRkqgfkgnsyrFLFGdvrehavlsnqakskpisfeddiaprvvpLYDQLVKLYGKIcywwvgpipminimdpdqLKEVFTKIndfqkpksnplgkilttglashegekwaKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLmstegsceldvwpyivnltsd
vtwawkilnwawlkpkrvekQLRKQGFKGNSYRFLFGDVREHAVLsnqakskpisfeddiaprVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINdfqkpksnplgkILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTegsceldvwpyivnltsd
VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPYIVNLTSD
*TWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQA**KPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQ*****PLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPYIVNL***
VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHA************FEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWEN*****GSCELDVWPYIVNLTSD
VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPYIVNLTSD
VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPYIVNLT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPYIVNLTSD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q05047 524 Secologanin synthase OS=C N/A no 1.0 0.360 0.486 5e-52
Q9SHG5 519 Cytochrome P450 72C1 OS=A no no 1.0 0.364 0.460 6e-50
O48786 520 Cytochrome P450 734A1 OS= no no 0.973 0.353 0.383 6e-35
B9X287 542 Cytochrome P450 734A6 OS= no no 0.973 0.339 0.350 2e-29
Q6Z6D6 557 Cytochrome P450 734A2 OS= no no 0.931 0.315 0.333 4e-27
Q69XM6 538 Cytochrome P450 734A4 OS= no no 0.915 0.321 0.314 2e-25
Q8LIF2 537 Cytochrome P450 734A5 OS= no no 0.888 0.312 0.313 3e-23
Q9FF18 518 Cytokinin hydroxylase OS= no no 0.952 0.347 0.274 2e-13
Q08477 520 Leukotriene-B(4) omega-hy yes no 0.645 0.234 0.367 7e-13
Q99N16 524 Leukotriene-B(4) omega-hy yes no 0.640 0.230 0.356 6e-12
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  203 bits (517), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 133/191 (69%), Gaps = 2/191 (1%)

Query: 1   VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDI 60
           + WAW++L+WAW  PKR+EK+LR+QGF+GN YRFL GDV+E   +  +A SKP+ F +DI
Sbjct: 21  MAWAWRVLDWAWFTPKRIEKRLRQQGFRGNPYRFLVGDVKESGKMHQEALSKPMEFNNDI 80

Query: 61  APRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQK--PKSNPLGKI 118
            PR++P  +  +  YG+  + W+G IP I++M+P+ +KEV T  + +QK     NPL K 
Sbjct: 81  VPRLMPHINHTINTYGRNSFTWMGRIPRIHVMEPELIKEVLTHSSKYQKNFDVHNPLVKF 140

Query: 119 LTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELD 178
           L TG+ S EG KW+KHR+II+PAF  EKLK MLPAF     ++++KWE +   +GS E+D
Sbjct: 141 LLTGVGSFEGAKWSKHRRIISPAFTLEKLKSMLPAFAICYHDMLTKWEKIAEKQGSHEVD 200

Query: 179 VWPYIVNLTSD 189
           ++P    LTSD
Sbjct: 201 IFPTFDVLTSD 211
Converts loganin into secologanin.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 3EC: .EC: 3EC: .EC: 9
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 Back     alignment and function description
>sp|Q08477|CP4F3_HUMAN Leukotriene-B(4) omega-hydroxylase 2 OS=Homo sapiens GN=CYP4F3 PE=2 SV=2 Back     alignment and function description
>sp|Q99N16|CP4F3_MOUSE Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
224105979 518 cytochrome P450 [Populus trichocarpa] gi 0.994 0.362 0.615 1e-64
224119134 518 cytochrome P450 [Populus trichocarpa] gi 0.994 0.362 0.610 1e-64
224113647 476 cytochrome P450 [Populus trichocarpa] gi 0.994 0.394 0.605 4e-64
449519735 524 PREDICTED: LOW QUALITY PROTEIN: secologa 0.984 0.354 0.580 2e-63
449524018 530 PREDICTED: LOW QUALITY PROTEIN: secologa 0.984 0.350 0.579 3e-63
224119126 518 cytochrome P450 [Populus trichocarpa] gi 0.994 0.362 0.605 3e-63
449456536 530 PREDICTED: secologanin synthase-like [Cu 0.984 0.350 0.579 3e-63
449456677 551 PREDICTED: secologanin synthase-like [Cu 0.984 0.337 0.569 1e-62
449519737 523 PREDICTED: secologanin synthase-like [Cu 0.984 0.355 0.569 2e-62
373501798 518 cytochrome P450 CYP72A129 [Panax ginseng 1.0 0.364 0.566 5e-62
>gi|224105979|ref|XP_002333744.1| cytochrome P450 [Populus trichocarpa] gi|222838385|gb|EEE76750.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/190 (61%), Positives = 149/190 (78%), Gaps = 2/190 (1%)

Query: 1   VTWAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDI 60
           + WAW++LNW W +PK+VE+ LR+QGF G  YR LFGD +E++ +  +A++KPI   D +
Sbjct: 18  LRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKENSDMLKEARTKPIGLSDAL 77

Query: 61  APRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILT 120
            PRV+P   QLVK YGK  + W+GP P +NIM+PDQ+++VF KIN++QKP S+PL K L 
Sbjct: 78  LPRVMPFLHQLVKDYGKNSFMWIGPKPRVNIMNPDQIRDVFMKINEYQKP-SHPLLKPLA 136

Query: 121 TGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMST-EGSCELDV 179
            GLASHEGEKWAKHRKIINPAFHQEKLKLM+PAF +SCS +I+KWE L+S  EGSCELDV
Sbjct: 137 CGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFYESCSGMINKWEKLVSVDEGSCELDV 196

Query: 180 WPYIVNLTSD 189
           WP +  LT D
Sbjct: 197 WPDLQGLTCD 206

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224119134|ref|XP_002331333.1| cytochrome P450 [Populus trichocarpa] gi|222873916|gb|EEF11047.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224113647|ref|XP_002332525.1| cytochrome P450 [Populus trichocarpa] gi|222832637|gb|EEE71114.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449519735|ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449524018|ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224119126|ref|XP_002331331.1| cytochrome P450 [Populus trichocarpa] gi|222873914|gb|EEF11045.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449456536|ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449456677|ref|XP_004146075.1| PREDICTED: secologanin synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449519737|ref|XP_004166891.1| PREDICTED: secologanin synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|373501798|gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
TAIR|locus:2089521 512 CYP72A15 ""cytochrome P450, fa 0.989 0.365 0.531 3.6e-57
TAIR|locus:2089586 512 CYP72A11 ""cytochrome P450, fa 0.989 0.365 0.521 1.8e-55
TAIR|locus:2089596 512 CYP72A13 ""cytochrome P450, fa 0.989 0.365 0.510 2.9e-55
TAIR|locus:2089531 515 CYP72A8 ""cytochrome P450, fam 0.989 0.363 0.515 1.9e-53
TAIR|locus:2089526 512 CYP72A7 ""cytochrome P450, fam 1.0 0.369 0.484 4.9e-53
TAIR|locus:2089621 512 CYP72A14 ""cytochrome P450, fa 0.989 0.365 0.515 4.9e-53
TAIR|locus:2089561 514 CYP72A10 ""cytochrome P450, fa 0.989 0.363 0.481 1e-52
TAIR|locus:2089546 508 CYP72A9 ""cytochrome P450, fam 1.0 0.372 0.513 4e-51
TAIR|locus:2043823 520 BAS1 "PHYB ACTIVATION TAGGED S 0.973 0.353 0.383 8.3e-35
UNIPROTKB|B9X287 542 CYP734A6 "Cytochrome P450 734A 0.989 0.345 0.353 6.3e-29
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 588 (212.0 bits), Expect = 3.6e-57, P = 3.6e-57
 Identities = 100/188 (53%), Positives = 140/188 (74%)

Query:     3 WAWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDIAP 62
             W W+ L W W KPK +E  LR+QG  G  Y  L GD++++  + ++A+SKP+   DDI+P
Sbjct:    20 WIWRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKKNFTMLSEARSKPLKLTDDISP 79

Query:    63 RVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTG 122
             RVVP   Q+ K YG+  + W GPIP I IMDP+Q+KEVF K+ DFQKP + PL  I+  G
Sbjct:    80 RVVPYPLQMFKTYGRTYFTWFGPIPTITIMDPEQIKEVFNKVYDFQKPHTFPLATIIAKG 139

Query:   123 LASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGS-CELDVWP 181
             LA+++G+KWAKHR+IINPAFH EK+K M+PAF+QSC E++ +W+ L+S +GS CE+DVWP
Sbjct:   140 LANYDGDKWAKHRRIINPAFHIEKIKNMVPAFHQSCREVVGEWDQLVSDKGSSCEVDVWP 199

Query:   182 YIVNLTSD 189
              +V++T+D
Sbjct:   200 GLVSMTAD 207
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B9X287 CYP734A6 "Cytochrome P450 734A6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP72A47
cytochrome P450 (518 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 7e-19
pfam00067 461 pfam00067, p450, Cytochrome P450 5e-13
COG2124 411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-06
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-05
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 6e-05
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information 
 Score = 82.9 bits (205), Expect = 7e-19
 Identities = 52/194 (26%), Positives = 95/194 (48%), Gaps = 13/194 (6%)

Query: 4   AWKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPI-SFEDDIAP 62
           A+  ++  +L P+R++K + +QG +G   R L G++ + + L +Q+ SK + S   DI  
Sbjct: 21  AYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTSKDMDSIHHDIVG 80

Query: 63  RVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDF-------QKPKSNPL 115
           R++P Y    K YGK   +W G  P + + + + +KE+ TK N         Q+   + +
Sbjct: 81  RLLPHYVAWSKQYGKRFIYWNGTEPRLCLTETELIKELLTKYNTVTGKSWLQQQGTKHFI 140

Query: 116 GKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSC 175
           G+    GL    G  W   R I  PAF  ++LK       +   +++   +  +   G  
Sbjct: 141 GR----GLLMANGADWYHQRHIAAPAFMGDRLKGYAGHMVECTKQMLQSLQKAVE-SGQT 195

Query: 176 ELDVWPYIVNLTSD 189
           E+++  Y+  LT+D
Sbjct: 196 EVEIGEYMTRLTAD 209

Length = 516
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
PLN02290 516 cytokinin trans-hydroxylase 99.95
PTZ00404 482 cytochrome P450; Provisional 99.93
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.92
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.89
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.89
PLN02687 517 flavonoid 3'-monooxygenase 99.88
PLN02394 503 trans-cinnamate 4-monooxygenase 99.88
PLN00168 519 Cytochrome P450; Provisional 99.87
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.87
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.87
PLN03112 514 cytochrome P450 family protein; Provisional 99.86
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.86
PLN02971 543 tryptophan N-hydroxylase 99.86
PLN02500 490 cytochrome P450 90B1 99.86
PLN02196 463 abscisic acid 8'-hydroxylase 99.86
PLN02183 516 ferulate 5-hydroxylase 99.85
PLN02738 633 carotene beta-ring hydroxylase 99.85
PLN02774 463 brassinosteroid-6-oxidase 99.85
PLN02966 502 cytochrome P450 83A1 99.85
PLN03234 499 cytochrome P450 83B1; Provisional 99.85
PLN02655 466 ent-kaurene oxidase 99.84
PLN02302 490 ent-kaurenoic acid oxidase 99.83
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.83
PLN02936 489 epsilon-ring hydroxylase 99.81
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.78
PLN03018 534 homomethionine N-hydroxylase 99.78
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.76
PLN02648 480 allene oxide synthase 99.76
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.75
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.65
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.01
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 98.9
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information 
Probab=99.95  E-value=2.5e-26  Score=186.97  Aligned_cols=182  Identities=26%  Similarity=0.497  Sum_probs=141.6

Q ss_pred             HHHHHhhchHHHHHHHHhcCCCCCCCcccCCCHHHHHHHhhhhcCCCCC-CCCCCCCchhHHHHHHHHHhCCeEEeecCC
Q 038814            7 ILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPIS-FEDDIAPRVVPLYDQLVKLYGKICYWWVGP   85 (189)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~Pgp~~~p~~G~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~   85 (189)
                      ++.++++.+++..++++++++|||+++|++||+.++.......+.+.+. ...++..+....+.+++++||+++.+++|+
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~PGP~~~P~iGnl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~i~~~~~g~  103 (516)
T PLN02290         24 TISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTSKDMDSIHHDIVGRLLPHYVAWSKQYGKRFIYWNGT  103 (516)
T ss_pred             HHHHHhccHHHHHHHHHHcCCCCCCCCcCCCCHHHHHHHHHHhhcCCCCCCCcccccccchHHHHHHHHhCCeEEEccCC
Confidence            3445677888999999999999999999999999886532221112121 122333344556789999999999999999


Q ss_pred             cCeEEecChHHHHHHHhccCCCCCCCCcc---hhhhccCCcccCCCchHHhhhcccCcccChHHHhhHHHHHHHHHHHHH
Q 038814           86 IPMINIMDPDQLKEVFTKINDFQKPKSNP---LGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEII  162 (189)
Q Consensus        86 ~~~v~i~~p~~~~~il~~~~~~~~~~~~~---~~~~~g~~l~~~~g~~wk~~R~~~~~~f~~~~l~~~~~~~~~~~~~~~  162 (189)
                      .++|+++||+.+++|+.+...+..+....   ....+|+|+++.+|+.|+.+||.++++|+.++++.+.+.+.+++++++
T Consensus       104 ~~~vvv~dp~~v~~il~~~~~~~~r~~~~~~~~~~~~g~~l~~~~g~~Wk~~Rk~~~~~f~~~~l~~~~~~i~~~~~~l~  183 (516)
T PLN02290        104 EPRLCLTETELIKELLTKYNTVTGKSWLQQQGTKHFIGRGLLMANGADWYHQRHIAAPAFMGDRLKGYAGHMVECTKQML  183 (516)
T ss_pred             ccEEEECCHHHHHHHHhcCCCCCCCcchhhhHHHHHhcCCccccCchHHHHHHhhcccccCHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999994434454444322   334568899999999999999999999999999999999999999999


Q ss_pred             HHHHHhhccCCCceeechHHHHhccCC
Q 038814          163 SKWENLMSTEGSCELDVWPYIVNLTSD  189 (189)
Q Consensus       163 ~~l~~~~~~~~~~~~d~~~~~~~~t~d  189 (189)
                      +.|.+... .++.++|+.+.++.+|+|
T Consensus       184 ~~l~~~~~-~~~~~vd~~~~~~~~~~~  209 (516)
T PLN02290        184 QSLQKAVE-SGQTEVEIGEYMTRLTAD  209 (516)
T ss_pred             HHHHHHHh-cCCceEEhHHHHHHHHHH
Confidence            99987543 233479999999998865

>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
3ua1_A 487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 6e-06
1w0e_A 485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 6e-06
1tqn_A 486 Crystal Structure Of Human Microsomal P450 3a4 Leng 6e-06
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure 
Iteration: 1

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 2/86 (2%)
Query: 73  KLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKI--LTTGLASHEGEK 130
           K YGK+  ++ G  P++ I DPD +K V  K          P G +  + + ++  E E+
Sbjct: 46  KKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEE 105
Query: 131 WAKHRKIINPAFHQEKLKLMLPAFNQ 156
           W + R +++P F   KLK M+P   Q
Sbjct: 106 WKRLRSLLSPTFTSGKLKEMVPIIAQ 131
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 7e-43
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 2e-38
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-37
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-27
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 1e-23
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 5e-22
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-19
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-18
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 3e-17
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 5e-17
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-16
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-12
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-11
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-10
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-09
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 9e-09
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 3e-07
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-04
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  147 bits (374), Expect = 7e-43
 Identities = 26/144 (18%), Positives = 61/144 (42%), Gaps = 10/144 (6%)

Query: 54  ISFEDDIAPRVVP-LYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEV-----FTKINDF 107
           ++ +D++  RV+  ++    K YG +    V     + +  P+ +K+      + K +  
Sbjct: 1   MAKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKM 60

Query: 108 QKPKSNPLGK-ILTTGL-ASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKW 165
            +      G+ +   GL +    E+W K R++I+ AF +  L  ++  FN+   +++   
Sbjct: 61  YRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEIL 120

Query: 166 ENLMSTEGSCELDVWPYIVNLTSD 189
           E     +G   + +   +     D
Sbjct: 121 EAKA--DGQTPVSMQDMLTYTAMD 142
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.93
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.9
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.89
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.85
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.85
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.84
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.84
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.84
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.84
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.84
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.84
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.84
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.83
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.83
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.82
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.82
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.82
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.81
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.81
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.81
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.8
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.8
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.79
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.75
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.75
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.72
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.71
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.7
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.68
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.67
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.67
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.66
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.64
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.63
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.63
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 99.63
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.62
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.62
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.62
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.61
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.61
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.6
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.6
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.59
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.59
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.59
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.59
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.59
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.58
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.58
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.57
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 99.57
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.56
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 99.55
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.54
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.54
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.54
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.53
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.53
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.53
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 99.5
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.5
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.48
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.48
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.48
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.46
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.46
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.44
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.4
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.39
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 99.36
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.31
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 99.31
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.3
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.2
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.1
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 98.01
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
Probab=99.93  E-value=2.4e-26  Score=184.02  Aligned_cols=152  Identities=20%  Similarity=0.332  Sum_probs=128.8

Q ss_pred             HHHHHHhcCCCCCCCcccCCCHHHHHHHhhhhcCCCCCCCCCCCCchhHHHHHHHHHhCCeEEeecCCcCeEEecChHHH
Q 038814           18 VEKQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQL   97 (189)
Q Consensus        18 ~~~~~~~~~~Pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~v~i~~p~~~   97 (189)
                      .+.+|+++++|||+++|++||+..+..                  +.+..+.+++++||+++++++|+.++|+++||+.+
T Consensus         7 ~~~~~k~~~~PGP~~~PliGn~~~~~~------------------~~~~~~~~~~~~yG~i~~~~~g~~~~vvv~dp~~i   68 (485)
T 3nxu_A            7 SHGLFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMI   68 (485)
T ss_dssp             CTTHHHHHTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHH
T ss_pred             cchHHhhCCCCCCCCcCeecCcHHhhc------------------ChHHHHHHHHHHcCCeEEEEeCCCCEEEECCHHHH
Confidence            356778889999999999999987632                  25678899999999999999999999999999999


Q ss_pred             HHHH-hc-cCCCCCCCCcchhhhccCCcccCCCchHHhhhcccCcccChHHHhhHHHHHHHHHHHHHHHHHHhhccCCCc
Q 038814           98 KEVF-TK-INDFQKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSC  175 (189)
Q Consensus        98 ~~il-~~-~~~~~~~~~~~~~~~~g~~l~~~~g~~wk~~R~~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~  175 (189)
                      ++|+ ++ .+.|.++.........+.++++.+|+.|+.+||+++++|+.+.++.+.+.++++++++++.+.+..+.+  .
T Consensus        69 ~~il~~~~~~~f~~r~~~~~~~~~~~~l~~~~g~~w~~~R~~~~~~fs~~~l~~~~~~i~~~~~~l~~~l~~~~~~g--~  146 (485)
T 3nxu_A           69 KTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG--K  146 (485)
T ss_dssp             HHHHTTTTTTTCCCCCCCSCCGGGGGSTTTCCHHHHHHHHHHHGGGGCHHHHHHHHHHHHHHHHHHHHHHHHHHHHT--C
T ss_pred             HHHHhccchhhccCCcccccccccccCccccCCcHHHHHHhhcChhcCHHHHHHHHHHHHHHHHHHHHHHHHHhccC--C
Confidence            9999 54 456766654443335678899999999999999999999999999999999999999999998754322  3


Q ss_pred             eeechHHHHhccCC
Q 038814          176 ELDVWPYIVNLTSD  189 (189)
Q Consensus       176 ~~d~~~~~~~~t~d  189 (189)
                      ++|+.+++..+|+|
T Consensus       147 ~~d~~~~~~~~~~d  160 (485)
T 3nxu_A          147 PVTLKDVFGAYSMD  160 (485)
T ss_dssp             CEEHHHHHHHHHHH
T ss_pred             cCcHHHHHHHHHHH
Confidence            89999999988865
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-11
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 4e-11
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-10
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-10
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 7e-10
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-09
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-09
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-07
d1odoa_ 401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-05
d1ueda_ 403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-04
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 59.3 bits (142), Expect = 3e-11
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 2/109 (1%)

Query: 59  DIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTK--INDFQKPKSNPLG 116
                      +  K YGK+  ++ G  P++ I DPD +K V  K   + F   +     
Sbjct: 25  SYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPV 84

Query: 117 KILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKW 165
             + + ++  E E+W + R +++P F   KLK M+P   Q    ++   
Sbjct: 85  GFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNL 133
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.93
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.91
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.81
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.81
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.78
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.76
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.75
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.67
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.61
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.58
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.55
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.55
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.49
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.39
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.32
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.26
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.17
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.16
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.14
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 98.82
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.77
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=6.2e-26  Score=178.57  Aligned_cols=150  Identities=20%  Similarity=0.324  Sum_probs=126.2

Q ss_pred             HHHHhcCCCCCCCcccCCCHHHHHHHhhhhcCCCCCCCCCCCCchhHHHHHHHHHhCCeEEeecCCcCeEEecChHHHHH
Q 038814           20 KQLRKQGFKGNSYRFLFGDVREHAVLSNQAKSKPISFEDDIAPRVVPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKE   99 (189)
Q Consensus        20 ~~~~~~~~Pgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yg~i~~~~~~~~~~v~i~~p~~~~~   99 (189)
                      ..||+++||||+++|++||++++..                  +.+.++.+++++||+||++++++.++|+|+||+.+++
T Consensus         4 ~~~~~~~iPGP~~~P~iG~~~~~~~------------------~~~~~~~~~~~kyG~i~~~~l~~~~~vvv~~p~~~~~   65 (472)
T d1tqna_           4 GLFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKT   65 (472)
T ss_dssp             THHHHTTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEEEEEETTEEEEEECCHHHHHH
T ss_pred             cchhhcCCCCCCCcCceeEHHHhhC------------------CHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHH
Confidence            4688899999999999999987642                  3677899999999999999999999999999999999


Q ss_pred             HH-hccCCC-CCCCCcchhhhccCCcccCCCchHHhhhcccCcccChHHHhhHHHHHHHHHHHHHHHHHHhhccCCCcee
Q 038814          100 VF-TKINDF-QKPKSNPLGKILTTGLASHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCEL  177 (189)
Q Consensus       100 il-~~~~~~-~~~~~~~~~~~~g~~l~~~~g~~wk~~R~~~~~~f~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  177 (189)
                      || ++...+ ..+.......+.++++++++|+.|+.+|++++++|+.+.++.+.+.+++.++.+++.|.+....+  ..+
T Consensus        66 il~~~~~~~~~~~~~~~~~~~~~~~i~~~~g~~~~~~R~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~--~~~  143 (472)
T d1tqna_          66 VLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETG--KPV  143 (472)
T ss_dssp             HHTTTTTTTCCBCCCCSCCGGGGGSTTTCCHHHHHHHHHHTTGGGSHHHHHTTHHHHHHHHHHHHHHHHHHHHHS--SCE
T ss_pred             HHhcCCcccccCCcccccccccCCceeccCcHHHHHhhhhcCccccchhhhcccchhhhhhhccccccccccccc--ccc
Confidence            99 444333 33333334445678999999999999999999999999999999999999999999998876433  379


Q ss_pred             echHHHHhccCC
Q 038814          178 DVWPYIVNLTSD  189 (189)
Q Consensus       178 d~~~~~~~~t~d  189 (189)
                      |+.+.+.++++|
T Consensus       144 dl~~~~~~~~~~  155 (472)
T d1tqna_         144 TLKDVFGAYSMD  155 (472)
T ss_dssp             EHHHHHHHHHHH
T ss_pred             hhhhhhhccchh
Confidence            999999988754
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure