Citrus Sinensis ID: 038822

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MAPIAVGDPLPDGTLVYFDEQDQLQQVSVHSLAAGKKVILFGVPGDFTPTCSLKHVPGFIEKADELQSKGVDEILCISVNDPFVMKAWAKTFPKNKSVKFLADGSAKYTHALGLELDLSEKGLGTQSRRFALLVDDLKVKAANVESGGDFTVSSADDILKSL
ccccccccccccEEEEEEcccccccEEEHHHHccccEEEEEEcccccccccccccccHHHHcHHHHHHccccEEEEEEEccHHHHHHHHHHccccccCEEEEcccccHHHHHccccccccccccccccEEEEEEEccEEEEEEECcccccEEccHHHHHHcc
*APIAVGDPLPDGTLVYFDEQDQLQQVSVHSLAAGKKVILFGVPGDFTPTCSLKHVPGFIEKADELQSKGVDEILCISVNDPFVMKAWAKTFPKNKSVKFLADGSAKYTHALGLELDLSEKGLGTQSRRFALLVDDLKVKAANVESGGDFTVSSADDILKSL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPIAVGDPLPDGTLVYFDEQDQLQQVSVHSLAAGKKVILFGVPGDFTPTCSLKHVPGFIEKADELQSKGVDEILCISVNDPFVMKAWAKTFPKNKSVKFLADGSAKYTHALGLELDLSEKGLGTQSRRFALLVDDLKVKAANVESGGDFTVSSADDILKSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxiredoxin-2B Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in intracellular redox signaling.confidentQ9XEX2
Peroxiredoxin-2C Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in intracellular redox signaling.confidentQ9FR35
Peroxiredoxin-2D Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in intracellular redox signaling.probableO22711

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.11.-.-Acting on a peroxide as acceptor.probable
1.11.1.-Peroxidases.probable
1.11.1.15Peroxiredoxin.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TP9, chain A
Confidence level:very confident
Coverage over the Query: 1-162
View the alignment between query and template
View the model in PyMOL