BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 038832
(337 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ZY2|A Chain A, Crystal Structure Of Pofut1 In Complex With Gdp (High
Resolution Dataset)
pdb|3ZY3|A Chain A, Crystal Structure Of Pofut1 In Complex With Gdp
(Crystal-Form-Iii)
pdb|3ZY3|B Chain B, Crystal Structure Of Pofut1 In Complex With Gdp
(Crystal-Form-Iii)
pdb|3ZY4|A Chain A, Crystal Structure Of Pofut1 Apo-Form (Crystal-Form-I)
pdb|3ZY5|A Chain A, Crystal Structure Of Pofut1 In Complex With Gdp-Fucose
(Crystal-Form-I)
pdb|3ZY6|A Chain A, Crystal Structure Of Pofut1 In Complex With Gdp-Fucose
(Crystal-Form-Ii)
Length = 362
Score = 29.6 bits (65), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 12/41 (29%), Positives = 23/41 (56%)
Query: 286 SVEEYLEKQKRVVQVQRHFLMNRPAKPFDLMHMVMHSVWLR 326
S+++YL R+ + + F+ AKPF +H+ + W+R
Sbjct: 186 SIQKYLRWSSRITEQAKKFISANLAKPFVAVHLRNDADWVR 226
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.139 0.444
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,461,939
Number of Sequences: 62578
Number of extensions: 420575
Number of successful extensions: 971
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 970
Number of HSP's gapped (non-prelim): 1
length of query: 337
length of database: 14,973,337
effective HSP length: 99
effective length of query: 238
effective length of database: 8,778,115
effective search space: 2089191370
effective search space used: 2089191370
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)