BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038832
         (337 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ZY2|A Chain A, Crystal Structure Of Pofut1 In Complex With Gdp (High
           Resolution Dataset)
 pdb|3ZY3|A Chain A, Crystal Structure Of Pofut1 In Complex With Gdp
           (Crystal-Form-Iii)
 pdb|3ZY3|B Chain B, Crystal Structure Of Pofut1 In Complex With Gdp
           (Crystal-Form-Iii)
 pdb|3ZY4|A Chain A, Crystal Structure Of Pofut1 Apo-Form (Crystal-Form-I)
 pdb|3ZY5|A Chain A, Crystal Structure Of Pofut1 In Complex With Gdp-Fucose
           (Crystal-Form-I)
 pdb|3ZY6|A Chain A, Crystal Structure Of Pofut1 In Complex With Gdp-Fucose
           (Crystal-Form-Ii)
          Length = 362

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 286 SVEEYLEKQKRVVQVQRHFLMNRPAKPFDLMHMVMHSVWLR 326
           S+++YL    R+ +  + F+    AKPF  +H+   + W+R
Sbjct: 186 SIQKYLRWSSRITEQAKKFISANLAKPFVAVHLRNDADWVR 226


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.444 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,461,939
Number of Sequences: 62578
Number of extensions: 420575
Number of successful extensions: 971
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 970
Number of HSP's gapped (non-prelim): 1
length of query: 337
length of database: 14,973,337
effective HSP length: 99
effective length of query: 238
effective length of database: 8,778,115
effective search space: 2089191370
effective search space used: 2089191370
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)