Citrus Sinensis ID: 038896

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
SWFGSLRKRNEAPFAAKPQEKILKNKKMSQRKQTLFILSLVLLWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMSACAILSYVSIVFLKIVPLQTVKSRSQLAKIATLSTVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTFKREAWVTYATLVPVVAGVVIASEGEPGFHLYGFIMCISATAARAFKSVLQGILLSSEGERLNSMNLLLYMSPIAVLVLLPAALIMEPKVLEVIVSLGRQHKFLWLLLLINSTMAYSANLLNFLVTKHTSALTLQVLGNAKGAVAVVISILLFRNPVTFIGIAGYTMTVLGVAAYGEAKRRYR
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc
********************************QTLFILSLVLLWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMSACAILSYVSIVFLKIVPLQTVKSRSQLAKIATLSTVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTFKREAWVTYATLVPVVAGVVIASEGEPGFHLYGFIMCISATAARAFKSVLQGILLSSEGERLNSMNLLLYMSPIAVLVLLPAALIMEPKVLEVIVSLGRQHKFLWLLLLINSTMAYSANLLNFLVTKHTSALTLQVLGNAKGAVAVVISILLFRNPVTFIGIAGYTMTVLGVAAYGEAKR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SWFGSLRKRNEAPFAAKPQEKILKNKKMSQRKQTLFILSLVLLWYSSNIGVLLLNKYLLSNYGFRFPIFLTMCHMSACAILSYVSIVFLKIVPLQTVKSRSQLAKIATLSTVFCGSVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTFKREAWVTYATLVPVVAGVVIASEGEPGFHLYGFIMCISATAARAFKSVLQGILLSSEGERLNSMNLLLYMSPIAVLVLLPAALIMEPKVLEVIVSLGRQHKFLWLLLLINSTMAYSANLLNFLVTKHTSALTLQVLGNAKGAVAVVISILLFRNPVTFIGIAGYTMTVLGVAAYGEAKRRYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable sugar phosphate/phosphate translocator At3g10290 confidentQ9SS40
Probable sugar phosphate/phosphate translocator At5g04160 probableQ9FYE5
Probable sugar phosphate/phosphate translocator At5g05820 probableQ6DBP3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 107-177
View the alignment between query and template
View the model in PyMOL
Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 271-329
View the alignment between query and template
View the model in PyMOL