Citrus Sinensis ID: 038932


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MATATSSINTINRVKIHEVTKITPMMIPDDDELICLPLTLFDTYWLKFLPVERLFFYEVADLTWDLFDSEILPKLKHSLSLTLGLHYLPLAGHMMWPEHAAKPAIYYFLPGQDQKEDIVNGVTVAVAESEGLDFDVLSGDGIRQAVEFRALTPQLSISDNKAEVVSIQITLFPKQGFCIGISNHHAFFDGRSTMMFIKSWAYLCKQYLDMENASSQQQQTTICLPSELIPSFDRAFINENDPKGFDLVYVNNWLSFTGNDRSLKVLPSFNDVNKLVRATYVLTRAHLKKLRDKLLLLEDRNRQTSPNKLHLSTFVLACAYVFTCMVKARGGESDRDVILAFTADYRSRLDPPVPTNYFGNCVGSHTRLVKARDFVEEPAATGLGGVAFVAHKLSEMVQEIGGGLTIQGFDEEKLVKLMAVMQRVSQGGQGLGVAGSIHFDVYGSDFGWGRPKKVEIVSIDTTGAVSLAESRHGDGGVEVGLALGKQDMDNFASFFDQGLKDLIV
cccccccccccccEEEEEEEEECcccccccccccccccccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHccccccccCEEcccccccccEEEccccccccccccccEEEEEEECccccccccccccccHHHHHHccccccccccccccEEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcHHHHHHHHHHHHHHHHcccccccccccccEEEHHHHHHHHHHHHHccccccccEEEEEEEccccccccccccccccccccccCEEECHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccEEEEEEEccccEEEEEEcccccccEEEEEEccHHHHHHHHHHHHHHcccccc
**********INRVKIHEVTKITPMMIPDDDELICLPLTLFDTYWLKFLPVERLFFYEVADLTWDLFDSEILPKLKHSLSLTLGLHYLPLAGHMMWPEHAAKPAIYYFLPGQDQKEDIVNGVTVAVAESEGLDFDVLSGDGIRQAVEFRALTPQLSISDNKAEVVSIQITLFPKQGFCIGISNHHAFFDGRSTMMFIKSWAYLCKQYLDME*******QTTICLPSELIPSFDRAFINENDPKGFDLVYVNNWLS*****RSLKVLPSFNDVNKLVRATYVLTRAHLKKLRDKLLLLEDR*******KLHLSTFVLACAYVFTCMVKARGGESDRDVILAFTADYRSRLDPPVPTNYFGNCVGSHTRLVKARDFVEEPAATGLGGVAFVAHKLSEMVQEIGGGLTIQGFDEEKLVKLMAVMQRVSQGGQGLGVAGSIHFDVYGSDFGWGRPKKVEIVSIDTTGAVSLAESRHGDGGVEVGLALGKQDMDNFASFFDQGLKDLIV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATATSSINTINRVKIHEVTKITPMMIPDDDELICLPLTLFDTYWLKFLPVERLFFYEVADLTWDLFDSEILPKLKHSLSLTLGLHYLPLAGHMMWPEHAAKPAIYYFLPGQDQKEDIVNGVTVAVAESEGLDFDVLSGDGIRQAVEFRALTPQLSISDNKAEVVSIQITLFPKQGFCIGISNHHAFFDGRSTMMFIKSWAYLCKQYLDMENASSQQQQTTICLPSELIPSFDRAFINENDPKGFDLVYVNNWLSFTGNDRSLKVLPSFNDVNKLVRATYVLTRAHLKKLRDKLLLLEDRNRQTSPNKLHLSTFVLACAYVFTCMVKARGGESDRDVILAFTADYRSRLDPPVPTNYFGNCVGSHTRLVKARDFVEEPAATGLGGVAFVAHKLSEMVQEIGGGLTIQGFDEEKLVKLMAVMQRVSQGGQGLGVAGSIHFDVYGSDFGWGRPKKVEIVSIDTTGAVSLAESRHGDGGVEVGLALGKQDMDNFASFFDQGLKDLIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Malonyl-CoA:anthocyanidin 5-O-glucoside-6"-O-malonyltransferase Involved in the malonylation of the 5-O-glucose residue of anthocyanin. Acts only on anthocyanin substrates containing a 5-O glucosyl moiety. Not able to catalyze acyl transfer using acetyl-CoA, butyryl-CoA, hexanoyl- CoA, benzoyl-CoA, cinnamoyl-CoA, methylmalonyl-CoA, succinyl-CoA, p-coumaroyl-CoA or caffeoyl-CoA.probableQ9LJB4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XR7, chain A
Confidence level:very confident
Coverage over the Query: 14-502
View the alignment between query and template
View the model in PyMOL
Template: 2E1T, chain A
Confidence level:confident
Coverage over the Query: 36-107,119-260,276-499
View the alignment between query and template
View the model in PyMOL