Query         038963
Match_columns 117
No_of_seqs    158 out of 1067
Neff          7.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:01:25 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038963.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038963hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3882 Tetraspanin family int  99.7 2.1E-17 4.5E-22  122.6   6.9   85    3-117     5-89  (237)
  2 PF00335 Tetraspannin:  Tetrasp  99.1 1.6E-11 3.4E-16   87.3   0.0   82    6-117     1-82  (221)
  3 PF05915 DUF872:  Eukaryotic pr  67.6      10 0.00022   25.5   3.7   25   12-36     44-68  (115)
  4 cd07912 Tweety_N N-terminal do  58.4      16 0.00035   29.9   3.9   29   87-115   215-243 (418)
  5 PF11297 DUF3098:  Protein of u  56.0      16 0.00036   22.4   2.8   25   14-38      6-30  (69)
  6 PF04156 IncA:  IncA protein;    55.5      18 0.00038   25.7   3.4   23   12-34      5-27  (191)
  7 PF15345 TMEM51:  Transmembrane  54.9      26 0.00055   26.5   4.3   16   82-97     62-77  (233)
  8 KOG4433 Tweety transmembrane/c  54.4      21 0.00045   30.0   4.0   31   86-116   215-245 (526)
  9 PF04906 Tweety:  Tweety;  Inte  51.8      17 0.00038   29.4   3.2   27   89-115   194-220 (406)
 10 PF04103 CD20:  CD20-like famil  50.1     5.3 0.00012   26.7   0.0   29   87-115    37-65  (150)
 11 PF01601 Corona_S2:  Coronaviru  46.3     6.6 0.00014   33.5   0.0   16   78-93    547-562 (610)
 12 PRK11901 hypothetical protein;  46.2      25 0.00053   27.9   3.1   24   82-105    37-60  (327)
 13 PF10176 DUF2370:  Protein of u  43.6      36 0.00078   25.7   3.6   32   77-108   193-224 (233)
 14 PF05640 NKAIN:  Na,K-Atpase In  41.2      34 0.00074   25.3   3.0   38   75-115    30-67  (200)
 15 KOG4556 Predicted membrane pro  36.2      54  0.0012   24.0   3.3   47   66-115    18-64  (205)
 16 PF11014 DUF2852:  Protein of u  32.0      41 0.00089   22.7   2.1   23   10-32     13-36  (115)
 17 PF06724 DUF1206:  Domain of Un  30.4      53  0.0011   19.6   2.2   20   16-35     48-67  (73)
 18 PF15048 OSTbeta:  Organic solu  30.2      79  0.0017   21.7   3.2   28    8-35     36-63  (125)
 19 PF04854 DUF624:  Protein of un  28.1      66  0.0014   19.2   2.4   19   12-30      2-23  (77)
 20 COG2149 Predicted membrane pro  26.7   1E+02  0.0023   20.9   3.3   25   15-39     60-84  (120)
 21 PF11127 DUF2892:  Protein of u  26.7      65  0.0014   18.8   2.2   23   82-104    34-56  (66)
 22 PRK07946 putative monovalent c  25.4      48   0.001   23.7   1.6   20   15-34      4-23  (163)
 23 TIGR01167 LPXTG_anchor LPXTG-m  25.2      68  0.0015   16.0   1.8   19   17-35     12-30  (34)
 24 PF13706 PepSY_TM_3:  PepSY-ass  24.8 1.2E+02  0.0025   15.9   3.3   24   82-105    10-33  (37)
 25 PF13179 DUF4006:  Family of un  24.3 1.1E+02  0.0024   18.6   2.8   26   82-107    15-40  (66)
 26 PF15471 TMEM171:  Transmembran  24.3      61  0.0013   25.3   2.1   22   12-33    112-133 (319)
 27 PF06166 DUF979:  Protein of un  23.9 1.4E+02   0.003   23.6   3.9   27   15-41      2-28  (308)
 28 PRK01844 hypothetical protein;  23.7 1.8E+02  0.0038   18.0   3.7   21   83-103     5-26  (72)
 29 PF11381 DUF3185:  Protein of u  23.2      59  0.0013   19.3   1.4   17   82-98     42-58  (59)
 30 PRK00523 hypothetical protein;  22.8   2E+02  0.0043   17.8   3.8   22   83-104     6-28  (72)
 31 PF03729 DUF308:  Short repeat   21.7      88  0.0019   17.8   2.1   23   83-105    24-46  (72)
 32 PRK12585 putative monovalent c  21.4 1.3E+02  0.0029   22.2   3.2   19   81-99      9-27  (197)
 33 PF03597 CcoS:  Cytochrome oxid  21.0 1.7E+02  0.0036   16.3   3.7   26   82-107     4-29  (45)
 34 PRK01741 cell division protein  20.7      53  0.0012   26.1   1.2   26   14-39      3-33  (332)
 35 PF10724 DUF2516:  Protein of u  20.4 2.6E+02  0.0057   18.2   5.8   31    9-39      3-33  (100)

No 1  
>KOG3882 consensus Tetraspanin family integral membrane protein [General function prediction only]
Probab=99.71  E-value=2.1e-17  Score=122.64  Aligned_cols=85  Identities=32%  Similarity=0.569  Sum_probs=71.3

Q ss_pred             CcchHHHHHHHHHHHHHHHHHHHHHHhheeEEecccccCCCCcCCCCCCCcccccCcchhhhhhhhhhhcccCChhHHHH
Q 038963            3 CRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPVSGDEGFVQLGRPMLMAVSLADSIFDKLPKAWFIY   82 (117)
Q Consensus         3 c~~~lk~~L~~~N~lf~i~G~~li~~G~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (117)
                      |.+|+||.++.+|+++|++|++++++|+|++.++....+....             .              .+.+   ++
T Consensus         5 ~~~~~K~~lf~~N~~~~l~G~~ll~~giw~~~~~~~~~~~~~~-------------~--------------~~~~---~~   54 (237)
T KOG3882|consen    5 GSSCLKYLLFLLNLLFWLLGLLLLAVGIWLLADKGFLSSLLES-------------D--------------FLVP---AY   54 (237)
T ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHhhhheeEeccchhhcccc-------------c--------------hhcc---hh
Confidence            4589999999999999999999999999999998765532210             0              0122   37


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhcccchhhhhhhcC
Q 038963           83 LFIGVGVVLFVISCVGCIGATTRNGCCLTCVSLVL  117 (117)
Q Consensus        83 ~li~~G~~~~~v~~~Gc~Ga~~en~~lL~~y~~~l  117 (117)
                      +++++|++++++|++||+||.|||||+|.+|++++
T Consensus        55 ili~~G~v~~~v~flGc~Ga~~es~~lL~~y~~~l   89 (237)
T KOG3882|consen   55 ILIAVGGVVFLVGFLGCCGALRESRCLLLSYFILL   89 (237)
T ss_pred             hhhhhhHHHHHHHHhhhhhhHhhhHHHHHHHHHHH
Confidence            99999999999999999999999999999998764


No 2  
>PF00335 Tetraspannin:  Tetraspanin family RDS_ROM1 subfamily;  InterPro: IPR018499 A number of eukaryotic CD antigens have been shown to be related []. CD9 (also called DRAP-27, MRP-1 or p24) upregulates HB-EGF activity as a receptor for diphtheria toxin as well as its juxtacrine activity. CD9 mAbs modulate cell adhesion and migration and trigger platelet activation that is blocked by mAbs directed to the platelet Fc receptor CD32. In mice, CD9 mAb KMC8.8 has been shown to inhibit the production of myeloid cells in vitro and has a costimulatory activity for T cells. CD9 is a type III membrane protein, with four putative transmembrane domains.  CD37 (or gp52-40) is involved in signal transduction and serves as a stable marker for malignancies derived from mature B cells, like B-CLL, HCL, and all types of B-NHL.  CD63 transfection reduced melanoma cell motility on fibronectin, collagen and laminin, and reduced the growth and metastasis of melanoma cells in nude mice []. CD63 has been used as a marker for late endosomes and for primary melanomas.  These proteins are all type II membrane proteins: they contain an N-terminal transmembrane (TM) domain, which acts both as a signal sequence and a membrane anchor, and 3 additional TM regions (hence the name 'TM4'). The sequences contain a number of conserved cysteine residues. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0016021 integral to membrane; PDB: 1IV5_A 1G8Q_A.
Probab=99.09  E-value=1.6e-11  Score=87.31  Aligned_cols=82  Identities=34%  Similarity=0.699  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhheeEEecccccCCCCcCCCCCCCcccccCcchhhhhhhhhhhcccCChhHHHHHHH
Q 038963            6 CLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPVSGDEGFVQLGRPMLMAVSLADSIFDKLPKAWFIYLFI   85 (117)
Q Consensus         6 ~lk~~L~~~N~lf~i~G~~li~~G~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li   85 (117)
                      |+|+.++++|+++++.|++++++|+|.+...+......+                              .......++++
T Consensus         1 c~k~~l~~~n~l~~l~g~~li~~g~~~~~~~~~~~~~~~------------------------------~~~~~~~~~~i   50 (221)
T PF00335_consen    1 CLKYILFFLNVLFLLLGLALIGVGIWLLVNNQYLSEFSS------------------------------SFISYVIIILI   50 (221)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccc------------------------------cchhHHHHHHH
Confidence            789999999999999999999999999422111110000                              00011236778


Q ss_pred             HHHHHHHHHHHHHHHHhhhcccchhhhhhhcC
Q 038963           86 GVGVVLFVISCVGCIGATTRNGCCLTCVSLVL  117 (117)
Q Consensus        86 ~~G~~~~~v~~~Gc~Ga~~en~~lL~~y~~~l  117 (117)
                      .+|.++++++++||+|+.||||+++..|.+++
T Consensus        51 ~~G~~~~~~~~~G~~~~~~~~~~~l~~y~~~~   82 (221)
T PF00335_consen   51 FIGIFILIISFLGCIGACRKNRCLLIIYIILL   82 (221)
T ss_dssp             --------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHhhcCcccccccccch
Confidence            89999999999999999999999999998753


No 3  
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=67.61  E-value=10  Score=25.53  Aligned_cols=25  Identities=28%  Similarity=0.440  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHHhheeEEec
Q 038963           12 KLLNFLLTIVGLAMVGYGIYLFVEY   36 (117)
Q Consensus        12 ~~~N~lf~i~G~~li~~G~w~~~~~   36 (117)
                      +.+-+.++++|..++..|..+....
T Consensus        44 I~la~~Lli~G~~li~~g~l~~~~~   68 (115)
T PF05915_consen   44 IALAVFLLIFGTVLIIIGLLLFFGH   68 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            4455677899999999998887653


No 4  
>cd07912 Tweety_N N-terminal domain of the protein encoded by the Drosophila tweety gene and related proteins, a family of chloride ion channels. The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C-terminus. This N-terminal domain contains the putative transmembrane spanning regions. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins.
Probab=58.36  E-value=16  Score=29.89  Aligned_cols=29  Identities=28%  Similarity=0.399  Sum_probs=23.4

Q ss_pred             HHHHHHHHHHHHHHHhhhcccchhhhhhh
Q 038963           87 VGVVLFVISCVGCIGATTRNGCCLTCVSL  115 (117)
Q Consensus        87 ~G~~~~~v~~~Gc~Ga~~en~~lL~~y~~  115 (117)
                      +=++.+++..++|+|..|.|||.+..+++
T Consensus       215 lL~~~lviC~~~l~gl~r~Sr~~li~~s~  243 (418)
T cd07912         215 LLSLLLVICLVLLVGLARHSRCLLIVFSV  243 (418)
T ss_pred             HHHHHHHHHHHHHHHHHHhcchHHHHHHH
Confidence            33456677888899999999999998854


No 5  
>PF11297 DUF3098:  Protein of unknown function (DUF3098);  InterPro: IPR021448  This bacterial family of proteins has no known function. 
Probab=56.01  E-value=16  Score=22.41  Aligned_cols=25  Identities=24%  Similarity=0.428  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHHHHhheeEEeccc
Q 038963           14 LNFLLTIVGLAMVGYGIYLFVEYKR   38 (117)
Q Consensus        14 ~N~lf~i~G~~li~~G~w~~~~~~~   38 (117)
                      -|.++..+|++++.+|-+...-..+
T Consensus         6 ~Nyill~iG~~vIilGfilMsg~~s   30 (69)
T PF11297_consen    6 KNYILLAIGIAVIILGFILMSGGGS   30 (69)
T ss_pred             HHHHHHHHHHHHHHHHHHheeCCCC
Confidence            4889999999999999998876443


No 6  
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=55.53  E-value=18  Score=25.65  Aligned_cols=23  Identities=26%  Similarity=0.688  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHHhheeEE
Q 038963           12 KLLNFLLTIVGLAMVGYGIYLFV   34 (117)
Q Consensus        12 ~~~N~lf~i~G~~li~~G~w~~~   34 (117)
                      .+.+++..++|+++++.|+-.+.
T Consensus         5 ~i~~i~~iilgilli~~gI~~Lv   27 (191)
T PF04156_consen    5 RIISIILIILGILLIASGIAALV   27 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            35566777777777777766643


No 7  
>PF15345 TMEM51:  Transmembrane protein 51
Probab=54.94  E-value=26  Score=26.53  Aligned_cols=16  Identities=38%  Similarity=0.877  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHH
Q 038963           82 YLFIGVGVVLFVISCV   97 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~   97 (117)
                      |+++++|+.+++++++
T Consensus        62 yVLVG~Gv~LLLLSIC   77 (233)
T PF15345_consen   62 YVLVGSGVALLLLSIC   77 (233)
T ss_pred             EehhhHHHHHHHHHHH
Confidence            7999999999999994


No 8  
>KOG4433 consensus Tweety transmembrane/cell surface protein [General function prediction only]
Probab=54.45  E-value=21  Score=29.96  Aligned_cols=31  Identities=26%  Similarity=0.386  Sum_probs=25.6

Q ss_pred             HHHHHHHHHHHHHHHHhhhcccchhhhhhhc
Q 038963           86 GVGVVLFVISCVGCIGATTRNGCCLTCVSLV  116 (117)
Q Consensus        86 ~~G~~~~~v~~~Gc~Ga~~en~~lL~~y~~~  116 (117)
                      ..=.+.+++-++++.|-.|+|||.+..|.++
T Consensus       215 ~lL~l~LvvC~v~vlglak~Skc~li~fsv~  245 (526)
T KOG4433|consen  215 LLLTLLLVVCLVLVLGLAKRSKCLLIVFSVC  245 (526)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcchhhhHHHHH
Confidence            3445677888999999999999999998763


No 9  
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=51.82  E-value=17  Score=29.36  Aligned_cols=27  Identities=26%  Similarity=0.534  Sum_probs=22.3

Q ss_pred             HHHHHHHHHHHHHhhhcccchhhhhhh
Q 038963           89 VVLFVISCVGCIGATTRNGCCLTCVSL  115 (117)
Q Consensus        89 ~~~~~v~~~Gc~Ga~~en~~lL~~y~~  115 (117)
                      .+.+++.++++.|..|+|||.+..+.+
T Consensus       194 ~l~l~icl~~l~glar~Sk~~li~~~v  220 (406)
T PF04906_consen  194 ILDLVICLLGLLGLARQSKCLLIVFSV  220 (406)
T ss_pred             HHHHHHHHHHHHHHHhcCcceEEEeee
Confidence            466678888999999999999987665


No 10 
>PF04103 CD20:  CD20-like family;  InterPro: IPR007237  This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulphide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm []. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts []. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton []. ; GO: 0016021 integral to membrane; PDB: 2OSL_Q 3BKY_P 3PP4_P.
Probab=50.10  E-value=5.3  Score=26.74  Aligned_cols=29  Identities=10%  Similarity=0.302  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHhhhcccchhhhhhh
Q 038963           87 VGVVLFVISCVGCIGATTRNGCCLTCVSL  115 (117)
Q Consensus        87 ~G~~~~~v~~~Gc~Ga~~en~~lL~~y~~  115 (117)
                      .|...++.|.+|.....|.+++++..+.+
T Consensus        37 ~G~~fiisG~l~i~s~k~~~~~lv~~~l~   65 (150)
T PF04103_consen   37 GGIFFIISGILGIASEKKPTKCLVIASLV   65 (150)
T ss_dssp             -----------------------------
T ss_pred             HHHHHHhhHHHHHHHhcCCcccchHHHHH
Confidence            47777888888988888888888766543


No 11 
>PF01601 Corona_S2:  Coronavirus S2 glycoprotein;  InterPro: IPR002552 The type I glycoprotein S of Coronavirus, trimers of which constitute the typical viral spikes, is assembled into virions through noncovalent interactions with the M protein. The spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 IPR002551 from INTERPRO and S2 []. Both chimeric S proteins appeared to cause cell fusion when expressed individually, suggesting that they were biologically fully active []. The spike is a type I membrane glycoprotein that possesses a conserved transmembrane anchor and an unusual cysteine-rich (cys) domain that bridges the putative junction of the anchor and the cytoplasmic tail [].; GO: 0006944 cellular membrane fusion, 0046813 virion attachment, binding of host cell surface receptor, 0016021 integral to membrane, 0019031 viral envelope; PDB: 2BEQ_B 2FXP_A 1ZVB_A 1WNC_D 1ZV8_H 1ZV7_B 1WYY_B 1ZVA_A 2BEZ_F 1WDG_A ....
Probab=46.34  E-value=6.6  Score=33.51  Aligned_cols=16  Identities=25%  Similarity=0.856  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHH
Q 038963           78 AWFIYLFIGVGVVLFV   93 (117)
Q Consensus        78 ~~~~~~li~~G~~~~~   93 (117)
                      ||++|+.|+++.+.++
T Consensus       547 PWyVWL~i~~~li~~~  562 (610)
T PF01601_consen  547 PWYVWLAIILALIAFA  562 (610)
T ss_dssp             ----------------
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4788888887766543


No 12 
>PRK11901 hypothetical protein; Reviewed
Probab=46.20  E-value=25  Score=27.94  Aligned_cols=24  Identities=17%  Similarity=0.445  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhc
Q 038963           82 YLFIGVGVVLFVISCVGCIGATTR  105 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~e  105 (117)
                      +++|++|++++++=++|...|+|.
T Consensus        37 h~MiGiGilVLlLLIi~IgSALks   60 (327)
T PRK11901         37 HMMIGIGILVLLLLIIAIGSALKS   60 (327)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhccC
Confidence            689999999999999999999873


No 13 
>PF10176 DUF2370:  Protein of unknown function (DUF2370);  InterPro: IPR019325 Proteins in this family are conserved from fungi to humans. They include the human NEDD4 family-interacting proteins and the yeast BSD2 metal homeostatis proteins. 
Probab=43.64  E-value=36  Score=25.73  Aligned_cols=32  Identities=16%  Similarity=0.464  Sum_probs=27.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHhhhcccc
Q 038963           77 KAWFIYLFIGVGVVLFVISCVGCIGATTRNGC  108 (117)
Q Consensus        77 ~~~~~~~li~~G~~~~~v~~~Gc~Ga~~en~~  108 (117)
                      .+|..|+++++|.++++-++.+.+=+.|--|.
T Consensus       193 ~~wla~~Lm~~G~fI~irsi~dY~rVKR~Er~  224 (233)
T PF10176_consen  193 NPWLAYILMAFGWFIFIRSIIDYWRVKRMERL  224 (233)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            35777999999999999999999988875553


No 14 
>PF05640 NKAIN:  Na,K-Atpase Interacting protein;  InterPro: IPR008516 NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localise to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterised domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer [].
Probab=41.19  E-value=34  Score=25.28  Aligned_cols=38  Identities=16%  Similarity=0.207  Sum_probs=24.0

Q ss_pred             CChhHHHHHHHHHHHHHHHHHHHHHHHhhhcccchhhhhhh
Q 038963           75 LPKAWFIYLFIGVGVVLFVISCVGCIGATTRNGCCLTCVSL  115 (117)
Q Consensus        75 ~~~~~~~~~li~~G~~~~~v~~~Gc~Ga~~en~~lL~~y~~  115 (117)
                      +...|.|++.-..-++.   -++|..||.+-++..+..|.+
T Consensus        30 LGyqWaPIl~NF~hIi~---vIlGlFG~~QyR~ryi~~Y~v   67 (200)
T PF05640_consen   30 LGYQWAPILANFLHIIF---VILGLFGAIQYRPRYIIVYAV   67 (200)
T ss_pred             HhhhHHHHHHHHHHHHH---HHHHHhhheeecchHHHHHHH
Confidence            33345445544444444   466677788888888888864


No 15 
>KOG4556 consensus Predicted membrane protein [Function unknown]
Probab=36.24  E-value=54  Score=24.00  Aligned_cols=47  Identities=23%  Similarity=0.277  Sum_probs=27.2

Q ss_pred             hhhhhhcccCChhHHHHHHHHHHHHHHHHHHHHHHHhhhcccchhhhhhh
Q 038963           66 SLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCIGATTRNGCCLTCVSL  115 (117)
Q Consensus        66 ~~~~~~~~~~~~~~~~~~li~~G~~~~~v~~~Gc~Ga~~en~~lL~~y~~  115 (117)
                      +++.+.+|.+...|.+++.=.+=+++.   ++|-.|+....+..+.+|..
T Consensus        18 ~l~RqvFDflGyqWapilanFvhIiiv---IlGLFGtiQyR~ryl~~y~~   64 (205)
T KOG4556|consen   18 SLERQVFDFLGYQWAPILANFVHIIIV---ILGLFGTIQYRRRYLYTYAS   64 (205)
T ss_pred             HHHHHHHHHhhhhhHHHHHHHHHHHHH---HHHhhhhhhcchhHHHHHHH
Confidence            344455554544454455545554444   45566778777777877753


No 16 
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=32.03  E-value=41  Score=22.70  Aligned_cols=23  Identities=30%  Similarity=0.508  Sum_probs=17.7

Q ss_pred             HHHHHHH-HHHHHHHHHHHHhhee
Q 038963           10 LLKLLNF-LLTIVGLAMVGYGIYL   32 (117)
Q Consensus        10 ~L~~~N~-lf~i~G~~li~~G~w~   32 (117)
                      .+.++-+ +||=+|++++++-+|-
T Consensus        13 a~mVlGFi~fWPlGla~Lay~iw~   36 (115)
T PF11014_consen   13 AAMVLGFIVFWPLGLALLAYMIWG   36 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444 4799999999999997


No 17 
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=30.37  E-value=53  Score=19.65  Aligned_cols=20  Identities=55%  Similarity=1.152  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHhheeEEe
Q 038963           16 FLLTIVGLAMVGYGIYLFVE   35 (117)
Q Consensus        16 ~lf~i~G~~li~~G~w~~~~   35 (117)
                      .+.+++|+.++++|+|...+
T Consensus        48 ~ll~~vg~gli~~gi~~~~~   67 (73)
T PF06724_consen   48 WLLGAVGLGLIGYGIWQFVK   67 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            67889999999999997643


No 18 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=30.25  E-value=79  Score=21.65  Aligned_cols=28  Identities=14%  Similarity=0.299  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhheeEEe
Q 038963            8 ECLLKLLNFLLTIVGLAMVGYGIYLFVE   35 (117)
Q Consensus         8 k~~L~~~N~lf~i~G~~li~~G~w~~~~   35 (117)
                      +|.+..+.++..++|+++++-++-+...
T Consensus        36 NysiL~Ls~vvlvi~~~LLgrsi~ANRn   63 (125)
T PF15048_consen   36 NYSILALSFVVLVISFFLLGRSIQANRN   63 (125)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHhHhccc
Confidence            6889999999999999999999887544


No 19 
>PF04854 DUF624:  Protein of unknown function, DUF624;  InterPro: IPR006938 This family consists of uncharacterised or hypothetical bacterial proteins.
Probab=28.11  E-value=66  Score=19.20  Aligned_cols=19  Identities=32%  Similarity=0.520  Sum_probs=13.5

Q ss_pred             HHHHHHHH---HHHHHHHHHhh
Q 038963           12 KLLNFLLT---IVGLAMVGYGI   30 (117)
Q Consensus        12 ~~~N~lf~---i~G~~li~~G~   30 (117)
                      ..+|++++   +.|+.++++|-
T Consensus         2 ~~ln~lwl~~~l~~l~v~tigP   23 (77)
T PF04854_consen    2 VVLNLLWLLFTLAGLPVFTIGP   23 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            46787777   77777766664


No 20 
>COG2149 Predicted membrane protein [Function unknown]
Probab=26.73  E-value=1e+02  Score=20.90  Aligned_cols=25  Identities=24%  Similarity=0.494  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHhheeEEecccc
Q 038963           15 NFLLTIVGLAMVGYGIYLFVEYKRA   39 (117)
Q Consensus        15 N~lf~i~G~~li~~G~w~~~~~~~~   39 (117)
                      -.+..+.|++.++.|.|-+.+.++.
T Consensus        60 g~fii~~gil~~a~g~~r~~~~~~a   84 (120)
T COG2149          60 GVFLILVGILLAALGALRWQRVERA   84 (120)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455678888888888876654443


No 21 
>PF11127 DUF2892:  Protein of unknown function (DUF2892);  InterPro: IPR021309  This family is conserved in bacteria. The function is not known. 
Probab=26.67  E-value=65  Score=18.78  Aligned_cols=23  Identities=26%  Similarity=0.303  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhh
Q 038963           82 YLFIGVGVVLFVISCVGCIGATT  104 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~  104 (117)
                      ++...+|+..+..++.|.|...+
T Consensus        34 ~~~~~~g~~ll~~g~~g~Cp~~~   56 (66)
T PF11127_consen   34 WLLGFVGAMLLVTGITGFCPLYA   56 (66)
T ss_pred             HHHHHHHHHHHHHHHHCcCHhHH
Confidence            57888999999999999988764


No 22 
>PRK07946 putative monovalent cation/H+ antiporter subunit C; Reviewed
Probab=25.42  E-value=48  Score=23.72  Aligned_cols=20  Identities=25%  Similarity=0.414  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHHhheeEE
Q 038963           15 NFLLTIVGLAMVGYGIYLFV   34 (117)
Q Consensus        15 N~lf~i~G~~li~~G~w~~~   34 (117)
                      |++..+...+++++|+|+..
T Consensus         4 ~l~~~i~~gvL~~~G~Ylll   23 (163)
T PRK07946          4 NLGLLVAIGVLTSAGVYLLL   23 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            34444444455555555544


No 23 
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=25.19  E-value=68  Score=15.96  Aligned_cols=19  Identities=37%  Similarity=0.688  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHhheeEEe
Q 038963           17 LLTIVGLAMVGYGIYLFVE   35 (117)
Q Consensus        17 lf~i~G~~li~~G~w~~~~   35 (117)
                      .+.+.|+++++.+.|....
T Consensus        12 ~~~~~G~~l~~~~~~~~~~   30 (34)
T TIGR01167        12 LLLLLGLLLLGLGGLLLRK   30 (34)
T ss_pred             HHHHHHHHHHHHHHHHhee
Confidence            4456677777777766544


No 24 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=24.84  E-value=1.2e+02  Score=15.87  Aligned_cols=24  Identities=29%  Similarity=0.437  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhc
Q 038963           82 YLFIGVGVVLFVISCVGCIGATTR  105 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~e  105 (117)
                      ++=+.+|.+++++.+-|.....++
T Consensus        10 W~Gl~~g~~l~~~~~tG~~~~f~~   33 (37)
T PF13706_consen   10 WLGLILGLLLFVIFLTGAVMVFRD   33 (37)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHH
Confidence            577889999999999998887754


No 25 
>PF13179 DUF4006:  Family of unknown function (DUF4006)
Probab=24.32  E-value=1.1e+02  Score=18.61  Aligned_cols=26  Identities=12%  Similarity=0.207  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhccc
Q 038963           82 YLFIGVGVVLFVISCVGCIGATTRNG  107 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~en~  107 (117)
                      -.++++-.++.+++++|++|..-+..
T Consensus        15 G~LIAvvLLLsIl~~lt~~ai~~Qq~   40 (66)
T PF13179_consen   15 GMLIAVVLLLSILAFLTYWAIKVQQE   40 (66)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            36888899999999999999775543


No 26 
>PF15471 TMEM171:  Transmembrane protein family 171
Probab=24.30  E-value=61  Score=25.33  Aligned_cols=22  Identities=23%  Similarity=0.490  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHHHHHHHhheeE
Q 038963           12 KLLNFLLTIVGLAMVGYGIYLF   33 (117)
Q Consensus        12 ~~~N~lf~i~G~~li~~G~w~~   33 (117)
                      .+|.|+|...|.++-.+|+|+-
T Consensus       112 LIFGFLFLTSGmLISvLGiWVP  133 (319)
T PF15471_consen  112 LIFGFLFLTSGMLISVLGIWVP  133 (319)
T ss_pred             HHHHHHHHhhhhhhhhheeeec
Confidence            4568899999999999999985


No 27 
>PF06166 DUF979:  Protein of unknown function (DUF979);  InterPro: IPR009323 This family consists of several putative bacterial membrane proteins. The function of this family is unclear.
Probab=23.85  E-value=1.4e+02  Score=23.60  Aligned_cols=27  Identities=7%  Similarity=0.249  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHHHHhheeEEecccccC
Q 038963           15 NFLLTIVGLAMVGYGIYLFVEYKRADN   41 (117)
Q Consensus        15 N~lf~i~G~~li~~G~w~~~~~~~~~~   41 (117)
                      +.+++++|+.++..+...+.|+++-.+
T Consensus         2 e~~Y~l~Gl~~~~~a~~~~~Dk~np~R   28 (308)
T PF06166_consen    2 EIFYILIGLVFIITAVRSLRDKTNPKR   28 (308)
T ss_pred             ccHHHHHHHHHHHHHHHHHcCCCCCcc
Confidence            568899999999999999988765443


No 28 
>PRK01844 hypothetical protein; Provisional
Probab=23.67  E-value=1.8e+02  Score=18.02  Aligned_cols=21  Identities=43%  Similarity=0.376  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHHH-HHHHhh
Q 038963           83 LFIGVGVVLFVISCV-GCIGAT  103 (117)
Q Consensus        83 ~li~~G~~~~~v~~~-Gc~Ga~  103 (117)
                      +.|.++++.+++|.+ |.++|-
T Consensus         5 ~~I~l~I~~li~G~~~Gff~ar   26 (72)
T PRK01844          5 LGILVGVVALVAGVALGFFIAR   26 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            334445555555544 666664


No 29 
>PF11381 DUF3185:  Protein of unknown function (DUF3185);  InterPro: IPR021521  Some members in this bacterial family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=23.20  E-value=59  Score=19.29  Aligned_cols=17  Identities=12%  Similarity=0.169  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 038963           82 YLFIGVGVVLFVISCVG   98 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~G   98 (117)
                      +..++.|++..++|+.+
T Consensus        42 ~~~ligG~va~ivGl~~   58 (59)
T PF11381_consen   42 IWYLIGGAVAVIVGLFL   58 (59)
T ss_pred             HHHHHhHHHHHHHHHhh
Confidence            45778888888888754


No 30 
>PRK00523 hypothetical protein; Provisional
Probab=22.84  E-value=2e+02  Score=17.81  Aligned_cols=22  Identities=23%  Similarity=0.600  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHH-HHHHhhh
Q 038963           83 LFIGVGVVLFVISCV-GCIGATT  104 (117)
Q Consensus        83 ~li~~G~~~~~v~~~-Gc~Ga~~  104 (117)
                      +.|.++++.+++|.+ |.+.|-|
T Consensus         6 l~I~l~i~~li~G~~~Gffiark   28 (72)
T PRK00523          6 LALGLGIPLLIVGGIIGYFVSKK   28 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            445555555656554 6666643


No 31 
>PF03729 DUF308:  Short repeat of unknown function (DUF308);  InterPro: IPR005325 This represents a group of short repeats that occurs in a limited number of membrane proteins. It may divide further in short repeats of around 7-10 residues of the pattern G-#-X(2)-#(2)-X (#=hydrophobic).
Probab=21.69  E-value=88  Score=17.81  Aligned_cols=23  Identities=30%  Similarity=0.326  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhc
Q 038963           83 LFIGVGVVLFVISCVGCIGATTR  105 (117)
Q Consensus        83 ~li~~G~~~~~v~~~Gc~Ga~~e  105 (117)
                      .....|..+++.|......+.++
T Consensus        24 ~~~i~g~~~i~~Gi~~l~~~~~~   46 (72)
T PF03729_consen   24 LAIILGIWLIISGIFQLISAFRR   46 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhc
Confidence            44566666666666666666653


No 32 
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=21.43  E-value=1.3e+02  Score=22.17  Aligned_cols=19  Identities=26%  Similarity=0.574  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 038963           81 IYLFIGVGVVLFVISCVGC   99 (117)
Q Consensus        81 ~~~li~~G~~~~~v~~~Gc   99 (117)
                      ..+++.+|++.+++|.+|.
T Consensus         9 ~~vLLliG~~f~ligaIGL   27 (197)
T PRK12585          9 ISIMILIGGLLSILAAIGV   27 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3578888988888887774


No 33 
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=21.04  E-value=1.7e+02  Score=16.26  Aligned_cols=26  Identities=23%  Similarity=0.363  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhccc
Q 038963           82 YLFIGVGVVLFVISCVGCIGATTRNG  107 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~en~  107 (117)
                      ++++.++.++..++...+.=|.|..+
T Consensus         4 ~~lip~sl~l~~~~l~~f~Wavk~GQ   29 (45)
T PF03597_consen    4 YILIPVSLILGLIALAAFLWAVKSGQ   29 (45)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHccCC
Confidence            56777777777777777777776553


No 34 
>PRK01741 cell division protein ZipA; Provisional
Probab=20.72  E-value=53  Score=26.14  Aligned_cols=26  Identities=35%  Similarity=0.497  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHH----HHHHhheeE-Eecccc
Q 038963           14 LNFLLTIVGLA----MVGYGIYLF-VEYKRA   39 (117)
Q Consensus        14 ~N~lf~i~G~~----li~~G~w~~-~~~~~~   39 (117)
                      +|.++.|+|++    +++-|+|.. .+|+.|
T Consensus         3 Ln~iliILg~lal~~Lv~hgiWsnRrEKSqy   33 (332)
T PRK01741          3 LNTILIILGILALVALVAHGIWSNRREKSQY   33 (332)
T ss_pred             ceehHHHHHHHHHHHHHHhhhhhhhhHHHHh
Confidence            35566555543    667899984 444444


No 35 
>PF10724 DUF2516:  Protein of unknown function (DUF2516);  InterPro: IPR019662  This entry represents a conserved protein in Actinobacteria. The function is not known. 
Probab=20.41  E-value=2.6e+02  Score=18.24  Aligned_cols=31  Identities=16%  Similarity=0.397  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhheeEEecccc
Q 038963            9 CLLKLLNFLLTIVGLAMVGYGIYLFVEYKRA   39 (117)
Q Consensus         9 ~~L~~~N~lf~i~G~~li~~G~w~~~~~~~~   39 (117)
                      .+.-+.+.+++++..+..++++|.+.+--..
T Consensus         3 ~l~~~~~~i~~~l~~~~~~~~v~Alv~aa~~   33 (100)
T PF10724_consen    3 FLFQIQGWILLALSLVALVLAVWALVDAARR   33 (100)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            3455677888899999999999999875433


Done!