BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038968
         (206 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3BVH|C Chain C, Crystal Structure Of Recombinant Gammad364a Fibrinogen
           Fragment D With The Peptide Ligand Gly-Pro-Arg-Pro-Amide
 pdb|3BVH|F Chain F, Crystal Structure Of Recombinant Gammad364a Fibrinogen
           Fragment D With The Peptide Ligand Gly-Pro-Arg-Pro-Amide
          Length = 293

 Score = 26.9 bits (58), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 72  WWMNTFSMKVLRGSFDEGATEYDEIERPVAYARVLKTWSKWVEQNVDPNRTTV 124
           WWMN      L G + +G T Y +   P  YA  +  W+ W  +     +TT+
Sbjct: 233 WWMNKCHAGHLNGVYYQGGT-YSKASTPNGYANGI-IWATWKTRWYSMKKTTM 283


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.135    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,604,260
Number of Sequences: 62578
Number of extensions: 270591
Number of successful extensions: 528
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 18
Number of HSP's that attempted gapping in prelim test: 528
Number of HSP's gapped (non-prelim): 18
length of query: 206
length of database: 14,973,337
effective HSP length: 94
effective length of query: 112
effective length of database: 9,091,005
effective search space: 1018192560
effective search space used: 1018192560
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)