BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 038968
(206 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BVH|C Chain C, Crystal Structure Of Recombinant Gammad364a Fibrinogen
Fragment D With The Peptide Ligand Gly-Pro-Arg-Pro-Amide
pdb|3BVH|F Chain F, Crystal Structure Of Recombinant Gammad364a Fibrinogen
Fragment D With The Peptide Ligand Gly-Pro-Arg-Pro-Amide
Length = 293
Score = 26.9 bits (58), Expect = 7.1, Method: Compositional matrix adjust.
Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%)
Query: 72 WWMNTFSMKVLRGSFDEGATEYDEIERPVAYARVLKTWSKWVEQNVDPNRTTV 124
WWMN L G + +G T Y + P YA + W+ W + +TT+
Sbjct: 233 WWMNKCHAGHLNGVYYQGGT-YSKASTPNGYANGI-IWATWKTRWYSMKKTTM 283
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.135 0.430
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,604,260
Number of Sequences: 62578
Number of extensions: 270591
Number of successful extensions: 528
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 18
Number of HSP's that attempted gapping in prelim test: 528
Number of HSP's gapped (non-prelim): 18
length of query: 206
length of database: 14,973,337
effective HSP length: 94
effective length of query: 112
effective length of database: 9,091,005
effective search space: 1018192560
effective search space used: 1018192560
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)