Query         038974
Match_columns 134
No_of_seqs    104 out of 820
Neff          7.1 
Searched_HMMs 46136
Date          Fri Mar 29 05:08:05 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038974.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038974hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 3.9E-46 8.4E-51  264.4   8.0  121    2-125     1-129 (129)
  2 PHA00692 hypothetical protein   49.7       7 0.00015   24.2   0.5    8    2-9      37-44  (74)
  3 PF07960 CBP4:  CBP4;  InterPro  42.0      13 0.00029   26.4   1.0   10    9-18     30-40  (128)
  4 PF13822 ACC_epsilon:  Acyl-CoA  35.5      20 0.00044   22.0   1.0    9    9-17     10-18  (62)
  5 smart00707 RPEL Repeat in Dros  31.3      35 0.00077   17.5   1.3   12    6-17      7-18  (26)
  6 COG3060 MetJ Transcriptional r  28.6      38 0.00083   22.6   1.4   38    9-53     51-90  (105)
  7 PF07131 DUF1382:  Protein of u  27.5      70  0.0015   19.8   2.4   20    4-23     22-48  (61)
  8 cd00490 Met_repressor_MetJ Met  27.1      69  0.0015   21.5   2.5   37    9-52     50-88  (103)
  9 PF01473 CW_binding_1:  Putativ  27.0      44 0.00095   15.2   1.1    7   58-64      8-14  (19)
 10 PF02375 JmjN:  jmjN domain;  I  26.7      38 0.00082   18.4   1.0   19    7-26      2-23  (34)
 11 PF12323 HTH_OrfB_IS605:  Helix  25.7      39 0.00085   19.0   1.0   11    6-16      7-17  (46)
 12 PF08672 APC2:  Anaphase promot  24.5      57  0.0012   19.9   1.6   19    8-26     31-49  (60)
 13 PRK10154 hypothetical protein;  24.2      42 0.00092   23.9   1.1   21  101-121    78-101 (134)
 14 cd00950 DHDPS Dihydrodipicolin  24.0      85  0.0018   24.4   2.9   24    2-26    102-125 (284)
 15 PF08990 Docking:  Erythronolid  24.0      43 0.00094   17.3   0.9   13   10-22      2-14  (27)
 16 PRK05264 transcriptional repre  23.4      84  0.0018   21.2   2.3   37    9-52     51-89  (105)
 17 PRK14390 hypothetical protein;  23.1      39 0.00085   21.0   0.7   14    1-14     12-25  (63)
 18 TIGR03874 4cys_cytochr c-type   22.9      61  0.0013   23.4   1.8   23    4-26     93-119 (143)
 19 PF08970 Sda:  Sporulation inhi  22.6      87  0.0019   18.3   2.0   17   10-26      4-21  (46)
 20 smart00265 BH4 BH4 Bcl-2 homol  21.0   1E+02  0.0022   15.9   1.9   17   10-26      3-20  (27)
 21 COG0020 UppS Undecaprenyl pyro  21.0      71  0.0015   25.1   1.9   35   12-50    172-210 (245)
 22 PF05848 CtsR:  Firmicute trans  20.9 1.3E+02  0.0029   22.0   3.2   37   12-50      4-44  (152)
 23 PF11141 DUF2914:  Protein of u  20.5 1.4E+02   0.003   18.4   2.8   21   79-104    42-62  (66)
 24 PF12043 DUF3527:  Domain of un  20.1 2.6E+02  0.0055   23.3   5.0   82   39-131    29-112 (346)
 25 PF10807 DUF2541:  Protein of u  20.1      61  0.0013   23.1   1.2   20  101-120    78-100 (134)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=3.9e-46  Score=264.38  Aligned_cols=121  Identities=33%  Similarity=0.596  Sum_probs=90.2

Q ss_pred             CCCCceEcCChHHHHH-HHHHhHcCCCCCCCC-CceEeccCCCCCCcccchhcccCCCccEEEEeeccc-cCCCC-ceee
Q 038974            2 LPPGVVFNPTEEDRVS-YLIGKVSGHTDGGGS-YFIQDIQLCEHEPWELLSLAHDCCHQQMYFTHLRSR-YHSEM-VYRE   77 (134)
Q Consensus         2 LP~G~rF~PtDeELi~-YL~~k~~g~~~~~~~-~~I~~~Dvy~~~Pw~L~~~~~~~~~~~~yFF~~~~~-~~~g~-~~R~   77 (134)
                      |||||||+|||+|||. ||.+|+.+.  +++. .+|.++|||+.|||+|+..... .+++||||+++++ +.+|. .+|+
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~--~~~~~~~i~~~Diy~~~P~~L~~~~~~-~~~~~yFF~~~~~~~~~~~r~~R~   77 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGE--PLPCEDVIHDVDIYSAHPWELPAKFKG-GDEEWYFFSPRKKKYPNGGRPNRV   77 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT---HHCS-CHSEE--GGGS-GGGCHHHSSS--SSEEEEEEE----------S-EE
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCC--CCCcccceeecccCccChHHhhhhccC-CCceEEEEEecccccCCccccccc
Confidence            8999999999999999 999999999  6665 7899999999999999953222 3379999999998 77776 8899


Q ss_pred             eccceeeecCCCceEeCCCCceEEEEEEEEEEe----cCCCCCeEEEEEEeC
Q 038974           78 AVCGFWKNLGLSSYINDKGGKPVAVKKSLNYYK----KDVKTQWLMTCTHFC  125 (134)
Q Consensus        78 ~~~G~Wk~~g~~~~i~~~~g~~iG~kk~~~fy~----~~~kt~W~M~Ey~l~  125 (134)
                      +++|+||++|+.++|.+.+|++||+|++|+||.    ++.+|+|+||||+|.
T Consensus        78 ~~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   78 TGGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             ETTEEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             ccceEEeecccccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            999999999999999988889999999999996    567999999999984


No 2  
>PHA00692 hypothetical protein
Probab=49.73  E-value=7  Score=24.21  Aligned_cols=8  Identities=50%  Similarity=1.136  Sum_probs=6.5

Q ss_pred             CCCCceEc
Q 038974            2 LPPGVVFN    9 (134)
Q Consensus         2 LP~G~rF~    9 (134)
                      .||||||-
T Consensus        37 yppgfrfg   44 (74)
T PHA00692         37 YPPGFRFG   44 (74)
T ss_pred             cCCCcccc
Confidence            58999985


No 3  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=41.96  E-value=13  Score=26.41  Aligned_cols=10  Identities=50%  Similarity=0.876  Sum_probs=8.8

Q ss_pred             cCChHHHHH-H
Q 038974            9 NPTEEDRVS-Y   18 (134)
Q Consensus         9 ~PtDeELi~-Y   18 (134)
                      .||||||+. |
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            699999998 5


No 4  
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=35.50  E-value=20  Score=22.00  Aligned_cols=9  Identities=44%  Similarity=0.811  Sum_probs=8.0

Q ss_pred             cCChHHHHH
Q 038974            9 NPTEEDRVS   17 (134)
Q Consensus         9 ~PtDeELi~   17 (134)
                      +||||||-.
T Consensus        10 nPt~eElAA   18 (62)
T PF13822_consen   10 NPTDEELAA   18 (62)
T ss_pred             CCCHHHHHH
Confidence            799999976


No 5  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=31.30  E-value=35  Score=17.50  Aligned_cols=12  Identities=25%  Similarity=0.318  Sum_probs=10.2

Q ss_pred             ceEcCChHHHHH
Q 038974            6 VVFNPTEEDRVS   17 (134)
Q Consensus         6 ~rF~PtDeELi~   17 (134)
                      ...+|+.+|||.
T Consensus         7 l~~RP~~eeLv~   18 (26)
T smart00707        7 LSQRPTREELEE   18 (26)
T ss_pred             HHcCCCHHHHHH
Confidence            457899999997


No 6  
>COG3060 MetJ Transcriptional regulator of met regulon [Transcription / Amino acid transport and metabolism]
Probab=28.59  E-value=38  Score=22.55  Aligned_cols=38  Identities=18%  Similarity=0.240  Sum_probs=28.7

Q ss_pred             cCChHHHHH--HHHHhHcCCCCCCCCCceEeccCCCCCCcccchhcc
Q 038974            9 NPTEEDRVS--YLIGKVSGHTDGGGSYFIQDIQLCEHEPWELLSLAH   53 (134)
Q Consensus         9 ~PtDeELi~--YL~~k~~g~~~~~~~~~I~~~Dvy~~~Pw~L~~~~~   53 (134)
                      |-|..||++  ||. -..|+  |+|.    +.|+-...|.++|+.+.
T Consensus        51 hatnsellceaflh-aftgq--plpt----d~dl~ker~deipe~ak   90 (105)
T COG3060          51 HATNSELLCEAFLH-AFTGQ--PLPT----DADLRKERSDEIPEAAK   90 (105)
T ss_pred             hhhhHHHHHHHHHH-HHcCC--CCCC----cHHHHHhccccchHHHH
Confidence            457788888  554 56788  8874    67888888999998763


No 7  
>PF07131 DUF1382:  Protein of unknown function (DUF1382);  InterPro: IPR009814 This entry is represented by Bacteriophage lambda, Xis. This entry overlaps with IPR009750, both representing lambda Xis. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical Escherichia coli and Bacteriophage lambda-like proteins of around 60 residues in length. The function of this family is unknown.
Probab=27.48  E-value=70  Score=19.76  Aligned_cols=20  Identities=35%  Similarity=0.497  Sum_probs=13.0

Q ss_pred             CCceEcC----ChHHHHH---HHHHhH
Q 038974            4 PGVVFNP----TEEDRVS---YLIGKV   23 (134)
Q Consensus         4 ~G~rF~P----tDeELi~---YL~~k~   23 (134)
                      .|+||.|    ||+|...   -|..|+
T Consensus        22 ~GIRFVpiPv~~dee~~~L~s~~~~kL   48 (61)
T PF07131_consen   22 IGIRFVPIPVVTDEEFHTLSSQLSQKL   48 (61)
T ss_pred             cCceeeccccccHHHHHHHHHHHHHHH
Confidence            5999998    5666544   444554


No 8  
>cd00490 Met_repressor_MetJ Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine.  MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence.  MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Probab=27.12  E-value=69  Score=21.47  Aligned_cols=37  Identities=19%  Similarity=0.232  Sum_probs=28.4

Q ss_pred             cCChHHHHH--HHHHhHcCCCCCCCCCceEeccCCCCCCcccchhc
Q 038974            9 NPTEEDRVS--YLIGKVSGHTDGGGSYFIQDIQLCEHEPWELLSLA   52 (134)
Q Consensus         9 ~PtDeELi~--YL~~k~~g~~~~~~~~~I~~~Dvy~~~Pw~L~~~~   52 (134)
                      |-|..||++  ||. -..|+  |+|.    +.|+-...|.++|..+
T Consensus        50 HATNSELLCEAFLH-AfTGQ--PLP~----D~Dl~K~~~d~iP~~a   88 (103)
T cd00490          50 HATNSELLCEAFLH-AFTGQ--PLPD----DADLRKERSDEIPEAA   88 (103)
T ss_pred             hcccHHHHHHHHHH-HhcCC--CCCC----hhhhhhcCcccccHHH
Confidence            457789998  665 46788  8885    5688888899998865


No 9  
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=27.00  E-value=44  Score=15.23  Aligned_cols=7  Identities=14%  Similarity=0.467  Sum_probs=5.6

Q ss_pred             ccEEEEe
Q 038974           58 QQMYFTH   64 (134)
Q Consensus        58 ~~~yFF~   64 (134)
                      +.||||.
T Consensus         8 ~~wYy~~   14 (19)
T PF01473_consen    8 GNWYYFD   14 (19)
T ss_dssp             TEEEEET
T ss_pred             CEEEEeC
Confidence            7899983


No 10 
>PF02375 JmjN:  jmjN domain;  InterPro: IPR003349 Jumonji protein is required for neural tube formation in mice [].There is evidence of domain swapping within the jumonji family of transcription factors []. This domain is often associated with JmjC (see IPR003347 from INTERPRO).; PDB: 2XML_A 2W2I_C 3DXT_A 3DXU_A 2OX0_B 2OQ6_B 2WWJ_A 2Q8D_A 3PDQ_A 2YBK_A ....
Probab=26.70  E-value=38  Score=18.41  Aligned_cols=19  Identities=32%  Similarity=0.532  Sum_probs=9.5

Q ss_pred             eEcCChHHHHH---HHHHhHcCC
Q 038974            7 VFNPTEEDRVS---YLIGKVSGH   26 (134)
Q Consensus         7 rF~PtDeELi~---YL~~k~~g~   26 (134)
                      .|+||.||--+   ||.. +...
T Consensus         2 vf~Pt~eEF~dp~~yi~~-i~~~   23 (34)
T PF02375_consen    2 VFYPTMEEFKDPIKYISS-IEPE   23 (34)
T ss_dssp             EE---HHHHS-HHHHHHH-HHHT
T ss_pred             cccCCHHHHhCHHHHHHH-HHHH
Confidence            48999999988   5544 4433


No 11 
>PF12323 HTH_OrfB_IS605:  Helix-turn-helix domain;  InterPro: IPR021027  This entry represents an N-terminal helix-turn-helix domain found in a variety of putative transposases [, , ]. It is usually associated with PF01385 from PFAM and PF07282 from PFAM. 
Probab=25.74  E-value=39  Score=18.99  Aligned_cols=11  Identities=27%  Similarity=0.359  Sum_probs=8.7

Q ss_pred             ceEcCChHHHH
Q 038974            6 VVFNPTEEDRV   16 (134)
Q Consensus         6 ~rF~PtDeELi   16 (134)
                      ||+.||+++..
T Consensus         7 ~rl~Pt~~Q~~   17 (46)
T PF12323_consen    7 YRLYPTKEQEE   17 (46)
T ss_pred             EEEecCHHHHH
Confidence            68899998754


No 12 
>PF08672 APC2:  Anaphase promoting complex (APC) subunit 2;  InterPro: IPR014786  The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome. Anaphase is initiated when the APC triggers the destruction of securin, thereby allowing the protease, separase, to disrupt sister-chromatid cohesion. Securin ubiquitination by the APC is inhibited by cyclin-dependent kinase 1 (Cdk1)-dependent phosphorylation []. Forkhead Box M1 (FoxM1), which is a transcription factor that is over-expressed in many cancers, is degraded in late mitosis and early G1 phase by the APC/cyclosome (APC/C) E3 ubiquitin ligase []. The APC/C targets mitotic cyclins for destruction in mitosis and G1 phase and is then inactivated at S phase. It thereby generates alternating states of high and low cyclin-Cdk activity, which is required for the alternation of mitosis and DNA replication []. The APC/C is composed of at least 13 subunits that stay tightly associated throughout the cell cycle: APC1, APC2, APC4, APC5, APC9, APC11, CDC16, CDC23, CDC26, CDC27, DOC1, MND2 and SWM1[], []. In fission yeast the 13 subunits are known as: Apc1, Apc2, Nuc2, Apc4, Apc5, Cut9, Apc8, Apc10, Apc11, Hcn1, Apc13, Apc14 and Apc15 []. This entry represents a C-terminal domain found in APC subunit 2. ; PDB: 1LDD_A.
Probab=24.52  E-value=57  Score=19.92  Aligned_cols=19  Identities=16%  Similarity=0.174  Sum_probs=14.6

Q ss_pred             EcCChHHHHHHHHHhHcCC
Q 038974            8 FNPTEEDRVSYLIGKVSGH   26 (134)
Q Consensus         8 F~PtDeELi~YL~~k~~g~   26 (134)
                      |..|.+||-.||-.++...
T Consensus        31 ~~~s~~eL~~fL~~lv~e~   49 (60)
T PF08672_consen   31 YDISLEELQEFLDRLVEEG   49 (60)
T ss_dssp             TT--HHHHHHHHHHHHHTT
T ss_pred             CCCCHHHHHHHHHHHHHCC
Confidence            5677888888999999887


No 13 
>PRK10154 hypothetical protein; Provisional
Probab=24.19  E-value=42  Score=23.88  Aligned_cols=21  Identities=24%  Similarity=0.395  Sum_probs=16.1

Q ss_pred             EEEEEEEEEe---cCCCCCeEEEE
Q 038974          101 AVKKSLNYYK---KDVKTQWLMTC  121 (134)
Q Consensus       101 G~kk~~~fy~---~~~kt~W~M~E  121 (134)
                      |..++|.|+.   ++..|+|+=--
T Consensus        78 g~s~tl~f~~~lk~~q~T~W~~~~  101 (134)
T PRK10154         78 SASQSLNIPSEIKEGQTTDWININ  101 (134)
T ss_pred             CCceEEecchhhccCCccccEEcc
Confidence            3448899988   78999998544


No 14 
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.
Probab=24.01  E-value=85  Score=24.42  Aligned_cols=24  Identities=13%  Similarity=0.155  Sum_probs=17.7

Q ss_pred             CCCCceEcCChHHHHHHHHHhHcCC
Q 038974            2 LPPGVVFNPTEEDRVSYLIGKVSGH   26 (134)
Q Consensus         2 LP~G~rF~PtDeELi~YL~~k~~g~   26 (134)
                      +||.| |.|++++|+.|.+.-+...
T Consensus       102 ~~P~~-~~~~~~~l~~~~~~ia~~~  125 (284)
T cd00950         102 VTPYY-NKPSQEGLYAHFKAIAEAT  125 (284)
T ss_pred             ccccc-CCCCHHHHHHHHHHHHhcC
Confidence            46644 8899999999777666554


No 15 
>PF08990 Docking:  Erythronolide synthase docking;  InterPro: IPR015083 The N-terminal docking domain found in modular polyketide synthase assumes an alpha-helical structure, wherein two alpha-helices are connected by a short loop. Two such N-terminal domains dimerise to form amphipathic parallel alpha-helical coiled coils: dimerisation is essential for protein function []. ; GO: 0016740 transferase activity, 0048037 cofactor binding; PDB: 2HG4_E.
Probab=23.97  E-value=43  Score=17.29  Aligned_cols=13  Identities=23%  Similarity=0.281  Sum_probs=7.9

Q ss_pred             CChHHHHHHHHHh
Q 038974           10 PTEEDRVSYLIGK   22 (134)
Q Consensus        10 PtDeELi~YL~~k   22 (134)
                      ++++.|.+||+.=
T Consensus         2 ~~e~kLr~YLkr~   14 (27)
T PF08990_consen    2 ANEDKLRDYLKRV   14 (27)
T ss_dssp             --HCHHHHHHHHH
T ss_pred             CcHHHHHHHHHHH
Confidence            3566777799753


No 16 
>PRK05264 transcriptional repressor protein MetJ; Provisional
Probab=23.36  E-value=84  Score=21.21  Aligned_cols=37  Identities=19%  Similarity=0.215  Sum_probs=28.3

Q ss_pred             cCChHHHHH--HHHHhHcCCCCCCCCCceEeccCCCCCCcccchhc
Q 038974            9 NPTEEDRVS--YLIGKVSGHTDGGGSYFIQDIQLCEHEPWELLSLA   52 (134)
Q Consensus         9 ~PtDeELi~--YL~~k~~g~~~~~~~~~I~~~Dvy~~~Pw~L~~~~   52 (134)
                      |-|..||++  ||. -..|+  |+|.    +-|+-...|-++|..+
T Consensus        51 HATNSELLCEAFLH-A~TGQ--PLP~----D~Dl~Kd~~d~ip~~a   89 (105)
T PRK05264         51 HATNSELLCEAFLH-AFTGQ--PLPD----DEDLRKERSDEIPEAA   89 (105)
T ss_pred             hcccHHHHHHHHHH-HHcCC--CCCC----hhhhhhcCcccchHHH
Confidence            457789998  665 46788  8885    5688888899998765


No 17 
>PRK14390 hypothetical protein; Provisional
Probab=23.11  E-value=39  Score=21.05  Aligned_cols=14  Identities=21%  Similarity=0.420  Sum_probs=11.3

Q ss_pred             CCCCCceEcCChHH
Q 038974            1 MLPPGVVFNPTEED   14 (134)
Q Consensus         1 ~LP~G~rF~PtDeE   14 (134)
                      .+|+-.||.||=.|
T Consensus        12 ~~~~~CRf~PTCS~   25 (63)
T PRK14390         12 FFGPRCRFIPSCSS   25 (63)
T ss_pred             CCCCCCCcCccHHH
Confidence            36889999999665


No 18 
>TIGR03874 4cys_cytochr c-type cytochrome, methanol metabolism-related. This family represents a c-type cytochrome related to (but excluding) cytochrome c-555 of Methylococcus capsulatus. Members contain four invariant Cys residues, including two from a heme-binding motif shared with c-555, and two others.
Probab=22.85  E-value=61  Score=23.42  Aligned_cols=23  Identities=22%  Similarity=0.167  Sum_probs=18.3

Q ss_pred             CCceEcCChH-HH---HHHHHHhHcCC
Q 038974            4 PGVVFNPTEE-DR---VSYLIGKVSGH   26 (134)
Q Consensus         4 ~G~rF~PtDe-EL---i~YL~~k~~g~   26 (134)
                      |+|.-..+|+ ||   +.||+....|.
T Consensus        93 PaF~~~LsD~~eIa~L~~YLR~~~~g~  119 (143)
T TIGR03874        93 PAFGDNPNVMCYLDDLYVYLRARGTDA  119 (143)
T ss_pred             CCccccCCcHHHHHHHHHHHHhccCCC
Confidence            7888899987 44   44999988887


No 19 
>PF08970 Sda:  Sporulation inhibitor A;  InterPro: IPR015064 Members of this protein group contain two antiparallel alpha helices that are linked by a highly structured inter-helix loop to form a helical hairpin; the structure is stabilised by numerous hydrophobic and electrostatic interactions. These sporulation inhibitors are antikinases that bind to the histidine kinase KinA phosphotransfer domain and act as a molecular barricade that inhibit productive interaction between the ATP binding site and the phosphorylatable KinA His residue. This results in the inhibition of sporulation (by preventing phosphorylation of spo0A) []. ; PDB: 3FYR_B 1PV0_A.
Probab=22.63  E-value=87  Score=18.30  Aligned_cols=17  Identities=12%  Similarity=-0.011  Sum_probs=12.4

Q ss_pred             CChHHHHH-HHHHhHcCC
Q 038974           10 PTEEDRVS-YLIGKVSGH   26 (134)
Q Consensus        10 PtDeELi~-YL~~k~~g~   26 (134)
                      =||+.||. |.+.+-.+-
T Consensus         4 LSDe~LiesY~~A~el~L   21 (46)
T PF08970_consen    4 LSDELLIESYHKAIELNL   21 (46)
T ss_dssp             S-HHHHHHHHHHHHHTT-
T ss_pred             ccHHHHHHHHHHHHHhCC
Confidence            37999999 998876665


No 20 
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=21.05  E-value=1e+02  Score=15.92  Aligned_cols=17  Identities=24%  Similarity=0.282  Sum_probs=13.9

Q ss_pred             CChHHHHH-HHHHhHcCC
Q 038974           10 PTEEDRVS-YLIGKVSGH   26 (134)
Q Consensus        10 PtDeELi~-YL~~k~~g~   26 (134)
                      .+-.|||. |+.-|+.-.
T Consensus         3 ~~nRelV~~yv~yKLsQr   20 (27)
T smart00265        3 LDNRELVVDYVTYKLSQN   20 (27)
T ss_pred             cchHHHHHHHHHHHHhhc
Confidence            35689999 999998766


No 21 
>COG0020 UppS Undecaprenyl pyrophosphate synthase [Lipid metabolism]
Probab=21.02  E-value=71  Score=25.10  Aligned_cols=35  Identities=23%  Similarity=0.325  Sum_probs=25.3

Q ss_pred             hHHHHH-HHHHhHcCCCCCCCCCceEe---ccCCCCCCcccch
Q 038974           12 EEDRVS-YLIGKVSGHTDGGGSYFIQD---IQLCEHEPWELLS   50 (134)
Q Consensus        12 DeELi~-YL~~k~~g~~~~~~~~~I~~---~Dvy~~~Pw~L~~   50 (134)
                      |||++. ||..  .+.  |-|+-+|.+   ..+-.+-||++.-
T Consensus       172 ~e~~i~~~L~~--~~~--pdpDLlIRTsGe~RlSnFllWQ~aY  210 (245)
T COG0020         172 DEELISSHLYT--SGL--PDPDLLIRTSGEQRLSNFLLWQSAY  210 (245)
T ss_pred             CHHHHHHhhcc--cCC--CCCCEEEeCCCcccccccHHHHHHh
Confidence            688888 9988  555  545556665   4777888999865


No 22 
>PF05848 CtsR:  Firmicute transcriptional repressor of class III stress genes (CtsR);  InterPro: IPR008463 This family consists of several Firmicute transcriptional repressor of class III stress gene (CtsR) proteins. CtsR of Listeria monocytogenes negatively regulates the clpC, clpP and clpE genes belonging to the CtsR regulon [].; PDB: 3H0D_A.
Probab=20.92  E-value=1.3e+02  Score=21.95  Aligned_cols=37  Identities=16%  Similarity=0.145  Sum_probs=23.5

Q ss_pred             hHHHHH-HHHHhHcCCCCCCCCCceEe---ccCCCCCCcccch
Q 038974           12 EEDRVS-YLIGKVSGHTDGGGSYFIQD---IQLCEHEPWELLS   50 (134)
Q Consensus        12 DeELi~-YL~~k~~g~~~~~~~~~I~~---~Dvy~~~Pw~L~~   50 (134)
                      =.++|. ||+..+...  +-..-.|.-   +|-+.|-|.++--
T Consensus         4 lSD~IE~yik~lL~~s--~~~~ieIqR~eLA~~F~CvPSQINY   44 (152)
T PF05848_consen    4 LSDIIEQYIKQLLEES--EEGQIEIQRNELAERFNCVPSQINY   44 (152)
T ss_dssp             HHHHHHHHHHHHHCTS--TTSEEEE-HHHHHHHTTS-THHHHH
T ss_pred             HHHHHHHHHHHHHHhC--CCCeEEEeHHHHHHHhCCchhhhhe
Confidence            357899 999998887  211112332   2668999999954


No 23 
>PF11141 DUF2914:  Protein of unknown function (DUF2914);  InterPro: IPR022606  This bacterial family of proteins has no known function. 
Probab=20.46  E-value=1.4e+02  Score=18.38  Aligned_cols=21  Identities=19%  Similarity=0.390  Sum_probs=14.7

Q ss_pred             ccceeeecCCCceEeCCCCceEEEEE
Q 038974           79 VCGFWKNLGLSSYINDKGGKPVAVKK  104 (134)
Q Consensus        79 ~~G~Wk~~g~~~~i~~~~g~~iG~kk  104 (134)
                      ..|-|+..     |.+.+|++||..+
T Consensus        42 ~~G~WrV~-----V~~~~G~~l~~~~   62 (66)
T PF11141_consen   42 QPGDWRVE-----VVDEDGQVLGSLR   62 (66)
T ss_pred             CCcCEEEE-----EEcCCCCEEEEEE
Confidence            45667755     6777888888754


No 24 
>PF12043 DUF3527:  Domain of unknown function (DUF3527);  InterPro: IPR021916  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is about 120 amino acids in length. This domain has a conserved CDCGGWD sequence motif. 
Probab=20.10  E-value=2.6e+02  Score=23.28  Aligned_cols=82  Identities=16%  Similarity=0.108  Sum_probs=42.8

Q ss_pred             cCCCCCCcccchhcccCCCccEEEEeeccccCCCCceeeeccceeeecCCCceEeCCCCceEEEEEEEEEEe-cCCCCC-
Q 038974           39 QLCEHEPWELLSLAHDCCHQQMYFTHLRSRYHSEMVYREAVCGFWKNLGLSSYINDKGGKPVAVKKSLNYYK-KDVKTQ-  116 (134)
Q Consensus        39 Dvy~~~Pw~L~~~~~~~~~~~~yFF~~~~~~~~g~~~R~~~~G~Wk~~g~~~~i~~~~g~~iG~kk~~~fy~-~~~kt~-  116 (134)
                      |||....|.+--...... +-.|-|.-.+       .++-+.|.|...+....=   .+.+||..++=.+.. ...+.+ 
T Consensus        29 ~VlaAt~~k~~~~~~~~~-~~vYTFhs~~-------e~KKks~~w~~~~~k~k~---~~~iVGQMkVSss~~~~~~~~~~   97 (346)
T PF12043_consen   29 EVLAATMWKSGSSDKNDL-NWVYTFHSIK-------EVKKKSGSWINSGDKNKS---SSNIVGQMKVSSSLSSEPSKQGS   97 (346)
T ss_pred             cEEEEEEeeccccccccc-ceEEEEEeec-------cccccccccccccccccC---CcceEEEEEeeeeeeecccCCcc
Confidence            677777777642211111 2335444331       112236667766532211   226899988866655 222222 


Q ss_pred             eEEEEEEeCCCCCCc
Q 038974          117 WLMTCTHFCTITSIR  131 (134)
Q Consensus       117 W~M~Ey~l~~~~~~~  131 (134)
                      =+..||.|-+.+.++
T Consensus        98 s~~~EFVLf~~~~~~  112 (346)
T PF12043_consen   98 SMVTEFVLFGVDHAR  112 (346)
T ss_pred             eeEEEEEEEeccccc
Confidence            477799988865543


No 25 
>PF10807 DUF2541:  Protein of unknown function (DUF2541);  InterPro: IPR020240 This entry represents proteins found in the Gammaproteobacteria that have no known function.
Probab=20.05  E-value=61  Score=23.13  Aligned_cols=20  Identities=20%  Similarity=0.529  Sum_probs=15.5

Q ss_pred             EEEEEEEEEe---cCCCCCeEEE
Q 038974          101 AVKKSLNYYK---KDVKTQWLMT  120 (134)
Q Consensus       101 G~kk~~~fy~---~~~kt~W~M~  120 (134)
                      |.-++|.|+.   ++.+|+|+--
T Consensus        78 g~s~~l~~~~~ikeg~tT~Wi~i  100 (134)
T PF10807_consen   78 GESQTLNFPRSIKEGQTTDWINI  100 (134)
T ss_pred             ccceEEcccccccCCCccCcEEe
Confidence            4447888888   7899999855


Done!