BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 038975
         (398 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2KMC|A Chain A, Solution Structure Of The N-Terminal Domain Of Kindlin-1
          Length = 102

 Score = 28.1 bits (61), Expect = 8.8,   Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 45 ANGQSKSELFHSVENDLFVGLGLNSGCAQADIGECWEDY 83
          ANG+ ++E+   V  DL +G  +     Q +I + W DY
Sbjct: 27 ANGEQQTEITLRVSGDLHIGGVMLKLVEQMNIAQDWSDY 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.133    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,629,990
Number of Sequences: 62578
Number of extensions: 460969
Number of successful extensions: 986
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 980
Number of HSP's gapped (non-prelim): 6
length of query: 398
length of database: 14,973,337
effective HSP length: 101
effective length of query: 297
effective length of database: 8,652,959
effective search space: 2569928823
effective search space used: 2569928823
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)