Query         038987
Match_columns 316
No_of_seqs    265 out of 669
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 05:16:29 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/038987.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/038987hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08325 WLM:  WLM domain;  Int 100.0 2.1E-42 4.6E-47  310.2  13.4  148    1-163    33-186 (186)
  2 KOG4842 Protein involved in si  99.7 2.1E-17 4.4E-22  154.6   4.3  160    1-174    62-236 (278)
  3 PF01863 DUF45:  Protein of unk  99.6 2.8E-15   6E-20  132.9   4.9   61   19-85    140-200 (205)
  4 COG1451 Predicted metal-depend  99.3 3.6E-12 7.9E-17  117.8   4.0   61   19-85    151-211 (223)
  5 KOG4842 Protein involved in si  99.2 4.6E-12   1E-16  119.0   4.3   85    1-87    149-241 (278)
  6 smart00731 SprT SprT homologue  98.1 1.7E-06 3.6E-11   74.7   2.0   58   19-80     33-96  (146)
  7 PF00641 zf-RanBP:  Zn-finger i  97.5 5.1E-05 1.1E-09   49.3   1.5   24  293-316     3-26  (30)
  8 PF10263 SprT-like:  SprT-like   97.2 0.00024 5.2E-09   60.8   2.8   58   19-80     31-99  (157)
  9 smart00547 ZnF_RBZ Zinc finger  97.1 0.00023 4.9E-09   44.5   1.0   23  294-316     2-24  (26)
 10 PF00641 zf-RanBP:  Zn-finger i  96.6 0.00073 1.6E-08   43.8   0.7   22  265-286     3-28  (30)
 11 smart00547 ZnF_RBZ Zinc finger  96.3  0.0021 4.6E-08   40.1   1.3   21  265-285     1-25  (26)
 12 PRK04351 hypothetical protein;  95.8  0.0094   2E-07   52.5   3.6   45   28-76     44-95  (149)
 13 PRK04860 hypothetical protein;  94.5   0.025 5.3E-07   50.4   2.4   33   44-76     58-97  (160)
 14 COG3091 SprT Zn-dependent meta  94.5   0.033 7.2E-07   49.6   3.1   31   46-76     58-95  (156)
 15 KOG4345 NF-kappa B regulator A  93.2    0.03 6.6E-07   59.6   0.6   23  294-316   185-207 (774)
 16 PF12773 DZR:  Double zinc ribb  92.4    0.11 2.4E-06   36.7   2.4   46  269-315     1-50  (50)
 17 KOG4198 RNA-binding Ran Zn-fin  92.1    0.13 2.8E-06   49.9   3.2   23  294-316   140-162 (280)
 18 PF06114 DUF955:  Domain of unk  91.0     0.3 6.5E-06   38.3   3.8   58   19-84     18-77  (122)
 19 COG0501 HtpX Zn-dependent prot  90.3    0.27 5.8E-06   45.9   3.4   58    5-67    117-175 (302)
 20 PRK03001 M48 family peptidase;  89.6    0.32 6.9E-06   46.3   3.3   41   19-64     99-139 (283)
 21 PRK04897 heat shock protein Ht  89.5    0.31 6.7E-06   47.0   3.2   43   19-66    112-154 (298)
 22 PRK02870 heat shock protein Ht  89.2     0.4 8.7E-06   47.4   3.8   53    7-64    135-188 (336)
 23 PRK03982 heat shock protein Ht  87.8     0.5 1.1E-05   45.1   3.4   45   19-68    100-144 (288)
 24 PF05569 Peptidase_M56:  BlaR1   87.5    0.86 1.9E-05   43.1   4.7   30   43-72    190-219 (299)
 25 COG4219 MecR1 Antirepressor re  87.4    0.32 6.9E-06   48.1   1.8   23   42-64    183-205 (337)
 26 KOG4477 RING1 interactor RYBP   87.3    0.34 7.3E-06   44.7   1.8   25  259-283    17-45  (228)
 27 PRK05457 heat shock protein Ht  87.0    0.56 1.2E-05   45.1   3.2   41   19-64    109-149 (284)
 28 PRK01345 heat shock protein Ht  87.0    0.54 1.2E-05   45.9   3.1   41   19-64     99-139 (317)
 29 KOG3931 Uncharacterized conser  86.8     1.1 2.3E-05   45.3   5.0   65   20-86     76-168 (484)
 30 PRK02391 heat shock protein Ht  85.7    0.69 1.5E-05   44.7   3.1   42   19-65    108-149 (296)
 31 PF04450 BSP:  Peptidase of pla  85.5    0.45 9.8E-06   43.9   1.6   57   28-85     74-132 (205)
 32 PRK03072 heat shock protein Ht  85.0    0.57 1.2E-05   45.0   2.1   25   43-67    121-145 (288)
 33 KOG4198 RNA-binding Ran Zn-fin  83.6    0.86 1.9E-05   44.3   2.7   53  262-314   136-201 (280)
 34 PRK01265 heat shock protein Ht  83.4     1.2 2.5E-05   44.0   3.6   42   19-65    115-156 (324)
 35 PF13485 Peptidase_MA_2:  Pepti  83.4    0.98 2.1E-05   35.7   2.6   24   44-67     20-43  (128)
 36 cd04270 ZnMc_TACE_like Zinc-de  83.4     0.9   2E-05   42.5   2.7   27   43-69    161-187 (244)
 37 PF01435 Peptidase_M48:  Peptid  82.8    0.64 1.4E-05   41.2   1.4   44   19-68     65-108 (226)
 38 PF12388 Peptidase_M57:  Dual-a  80.0     1.8 3.9E-05   40.5   3.4   42   22-69    112-153 (211)
 39 PF08325 WLM:  WLM domain;  Int  78.5     6.7 0.00014   35.8   6.5   78   47-125    84-185 (186)
 40 KOG3854 SPRT-like metalloprote  78.4     1.4 3.1E-05   45.6   2.3   53   27-85    335-397 (505)
 41 PF01447 Peptidase_M4:  Thermol  77.0     1.7 3.6E-05   38.3   2.1   21   41-61    127-147 (150)
 42 cd04271 ZnMc_ADAM_fungal Zinc-  75.2     1.1 2.5E-05   41.6   0.6   18   51-68    147-164 (228)
 43 cd04272 ZnMc_salivary_gland_MP  69.6     2.6 5.6E-05   38.4   1.5   19   50-68    146-164 (220)
 44 COG4900 Predicted metallopepti  69.5     7.3 0.00016   33.6   4.1   48   24-75     59-114 (133)
 45 cd04267 ZnMc_ADAM_like Zinc-de  67.6     2.8   6E-05   37.0   1.3   22   47-68    131-152 (192)
 46 TIGR02414 pepN_proteo aminopep  67.4     3.3 7.2E-05   45.8   2.1   20   45-64    279-298 (863)
 47 PF13688 Reprolysin_5:  Metallo  67.3     3.5 7.6E-05   36.3   1.9   26   44-69    137-162 (196)
 48 PF13582 Reprolysin_3:  Metallo  66.8     2.3 5.1E-05   34.5   0.6   16   51-66    109-124 (124)
 49 PF10026 DUF2268:  Predicted Zn  65.6     5.7 0.00012   35.9   2.9   47   28-79     49-98  (195)
 50 COG0308 PepN Aminopeptidase N   65.1       4 8.6E-05   45.0   2.1   23   43-65    301-323 (859)
 51 PF13248 zf-ribbon_3:  zinc-rib  65.1     3.3 7.2E-05   26.0   0.9   22  295-316     3-24  (26)
 52 cd04269 ZnMc_adamalysin_II_lik  64.1     5.2 0.00011   35.4   2.3   23   46-68    128-150 (194)
 53 PF14521 Aspzincin_M35:  Lysine  62.7     3.9 8.4E-05   35.6   1.2   39   29-69     78-116 (148)
 54 PRK14015 pepN aminopeptidase N  61.6     3.9 8.4E-05   45.4   1.3   19   46-64    293-311 (875)
 55 PF13574 Reprolysin_2:  Metallo  60.7       4 8.7E-05   36.1   1.0   20   49-68    111-130 (173)
 56 COG5100 NPL4 Nuclear pore prot  60.4     1.9 4.2E-05   44.2  -1.2   23  294-316   546-568 (571)
 57 PF01433 Peptidase_M1:  Peptida  59.5     6.9 0.00015   37.7   2.4   19   46-64    292-310 (390)
 58 PF15639 Tox-MPTase3:  Metallop  59.2     3.7 8.1E-05   35.9   0.5   34   26-60     71-111 (135)
 59 PF01421 Reprolysin:  Reprolysi  59.1     6.8 0.00015   34.8   2.2   25   44-68    126-150 (199)
 60 PF13240 zinc_ribbon_2:  zinc-r  59.0     5.3 0.00011   24.7   1.0   21  296-316     1-21  (23)
 61 PRK15410 DgsA anti-repressor M  58.0     9.7 0.00021   36.7   3.1   62   19-85    117-189 (260)
 62 PLN00162 transport protein sec  58.0     5.6 0.00012   43.4   1.7   35  266-307    53-88  (761)
 63 PF09768 Peptidase_M76:  Peptid  57.4     8.2 0.00018   35.0   2.4   19   43-61     65-83  (173)
 64 PF02102 Peptidase_M35:  Deuter  56.7     5.8 0.00013   39.8   1.5   20   48-67    296-317 (359)
 65 cd04273 ZnMc_ADAMTS_like Zinc-  56.2     2.9 6.3E-05   37.7  -0.7   20   49-68    140-159 (207)
 66 PF10460 Peptidase_M30:  Peptid  56.2     7.9 0.00017   39.0   2.3   41   23-64    114-154 (366)
 67 TIGR02412 pepN_strep_liv amino  55.5     6.6 0.00014   43.1   1.7   19   46-64    284-302 (831)
 68 cd00350 rubredoxin_like Rubred  55.5       9  0.0002   25.3   1.8   21  295-315     2-24  (33)
 69 PF13699 DUF4157:  Domain of un  55.3     4.5 9.8E-05   31.9   0.4   33   26-63     43-75  (79)
 70 PF12725 DUF3810:  Protein of u  54.9     3.6 7.8E-05   40.3  -0.3   45   44-88    191-237 (318)
 71 PF06262 DUF1025:  Possibl zinc  54.2     7.7 0.00017   32.0   1.6   16   47-62     71-86  (97)
 72 PF06167 Peptidase_M90:  Glucos  53.4      13 0.00029   35.4   3.3   65   19-86    127-202 (253)
 73 COG1773 Rubredoxin [Energy pro  53.0      12 0.00025   28.2   2.2   37  265-302     2-44  (55)
 74 PF00413 Peptidase_M10:  Matrix  52.7     5.5 0.00012   33.3   0.5   24   44-67    100-123 (154)
 75 PF13203 DUF2201_N:  Putative m  51.9      11 0.00023   35.7   2.4   47   27-77     42-98  (292)
 76 KOG4345 NF-kappa B regulator A  51.8     4.1 8.9E-05   44.1  -0.5   24  261-284    86-113 (774)
 77 TIGR02411 leuko_A4_hydro leuko  51.0     8.8 0.00019   40.7   1.8   16   49-64    279-294 (601)
 78 PRK14714 DNA polymerase II lar  50.7      14 0.00031   42.6   3.4   47  265-316   666-717 (1337)
 79 cd04278 ZnMc_MMP Zinc-dependen  50.3      18 0.00039   31.0   3.3   23   45-67    103-125 (157)
 80 KOG1046 Puromycin-sensitive am  49.4     9.4  0.0002   42.3   1.8   19   46-64    321-339 (882)
 81 PF04810 zf-Sec23_Sec24:  Sec23  49.2     6.2 0.00014   27.2   0.2   17  291-307    21-37  (40)
 82 PF10023 DUF2265:  Predicted am  47.8      30 0.00065   34.7   4.8   43   43-85    159-202 (337)
 83 cd00203 ZnMc Zinc-dependent me  47.6     9.4  0.0002   32.3   1.1   22   47-68     94-115 (167)
 84 cd04277 ZnMc_serralysin_like Z  42.4      28 0.00061   30.6   3.4   39   27-67     93-131 (186)
 85 PF13058 DUF3920:  Protein of u  41.7      11 0.00024   32.4   0.6   20   43-62     70-89  (126)
 86 cd04268 ZnMc_MMP_like Zinc-dep  41.3      19 0.00041   30.5   2.1   22   47-68     92-113 (165)
 87 cd00729 rubredoxin_SM Rubredox  39.8      19 0.00042   24.1   1.5   23  294-316     2-26  (34)
 88 PF10463 Peptidase_U49:  Peptid  39.2      14 0.00031   34.4   1.0   19   49-67    101-119 (206)
 89 KOG1244 Predicted transcriptio  38.8      13 0.00028   36.6   0.6   37  265-301   274-329 (336)
 90 COG5100 NPL4 Nuclear pore prot  38.5       7 0.00015   40.3  -1.2   20  265-284   545-568 (571)
 91 COG4324 Predicted aminopeptida  38.0      49  0.0011   32.7   4.4   47   45-91    193-240 (376)
 92 PF13583 Reprolysin_4:  Metallo  37.8      17 0.00037   33.1   1.3   18   51-68    139-156 (206)
 93 PF14891 Peptidase_M91:  Effect  35.7      12 0.00026   33.2  -0.0   19   50-68    104-122 (174)
 94 PF01457 Peptidase_M8:  Leishma  34.9      27 0.00058   36.4   2.3   30   29-62    194-223 (521)
 95 cd04279 ZnMc_MMP_like_1 Zinc-d  34.9      27 0.00059   29.8   2.0   23   46-68    101-123 (156)
 96 KOG3607 Meltrins, fertilins an  34.9      22 0.00047   38.9   1.7   22   46-67    320-341 (716)
 97 PF02318 FYVE_2:  FYVE-type zin  33.8      18  0.0004   30.2   0.8   38  268-315    56-101 (118)
 98 COG2856 Predicted Zn peptidase  33.4      30 0.00064   32.4   2.1   22   45-66     68-89  (213)
 99 PHA02456 zinc metallopeptidase  32.8      20 0.00044   31.0   0.9   16   47-62     77-92  (141)
100 KOG2719 Metalloprotease [Gener  32.3      24 0.00052   36.4   1.5   42   19-63    253-294 (428)
101 smart00235 ZnMc Zinc-dependent  31.8      21 0.00046   29.7   0.9   18   51-68     88-105 (140)
102 PRK11788 tetratricopeptide rep  30.7      33  0.0007   32.5   2.0   23  293-315   353-375 (389)
103 PF08434 CLCA_N:  Calcium-activ  30.3      12 0.00027   36.1  -0.9   43   20-63    121-163 (262)
104 PF07209 DUF1415:  Protein of u  30.3 1.7E+02  0.0037   26.8   6.4   56   29-91     33-102 (174)
105 PRK09672 phage exclusion prote  30.1      27 0.00059   34.5   1.4   18   49-66    165-182 (305)
106 PRK13267 archaemetzincin-like   29.9      38 0.00083   30.7   2.2   23   46-68    122-144 (179)
107 KOG1047 Bifunctional leukotrie  29.0      26 0.00055   37.5   1.0   19   47-65    286-304 (613)
108 COG3227 LasB Zinc metalloprote  28.6      15 0.00033   38.4  -0.6   58   21-81    308-381 (507)
109 PF05548 Peptidase_M11:  Gameto  27.6      31 0.00067   33.9   1.3   17   52-68    153-169 (314)
110 COG1198 PriA Primosomal protei  26.4      56  0.0012   35.9   3.1   49  266-316   435-483 (730)
111 PF15641 Tox-MPTase5:  Metallop  26.1      91   0.002   26.0   3.5   38   41-78     56-105 (109)
112 PRK12496 hypothetical protein;  25.5      46 0.00099   29.7   1.9    9  152-160    82-90  (164)
113 PF03833 PolC_DP2:  DNA polymer  25.4      23 0.00051   39.4   0.0   48  262-316   651-700 (900)
114 KOG3658 Tumor necrosis factor-  24.6      45 0.00097   36.5   1.9   45   25-69    366-412 (764)
115 COG1997 RPL43A Ribosomal prote  24.5      46   0.001   27.4   1.5   25  279-303    38-62  (89)
116 COG3824 Predicted Zn-dependent  24.4      36 0.00078   29.8   0.9   14   47-60    107-120 (136)
117 cd04327 ZnMc_MMP_like_3 Zinc-d  24.2      48   0.001   29.7   1.8   19   48-66     91-109 (198)
118 PF07998 Peptidase_M54:  Peptid  23.5      52  0.0011   30.4   1.9   23   46-68    142-164 (194)
119 KOG3314 Ku70-binding protein [  22.8      89  0.0019   28.8   3.1   19   43-61     85-103 (194)
120 COG4783 Putative Zn-dependent   22.2      48   0.001   34.8   1.5   34   27-63    111-144 (484)
121 KOG2760 Vacuolar sorting prote  22.0      60  0.0013   33.4   2.1   43  261-303    85-139 (432)
122 KOG1986 Vesicle coat complex C  21.8      64  0.0014   35.4   2.4   40  260-306    47-87  (745)
123 COG1592 Rubrerythrin [Energy p  21.7      44 0.00096   30.2   1.0   21  266-286   134-159 (166)
124 PF13398 Peptidase_M50B:  Pepti  21.4      52  0.0011   29.9   1.5   15   48-62     21-35  (200)
125 PF10103 DUF2342:  Uncharacteri  20.9      58  0.0013   32.5   1.8   38   44-81    152-189 (342)
126 PF10058 DUF2296:  Predicted in  20.9      63  0.0014   23.9   1.5   33  266-304    22-54  (54)
127 KOG1512 PHD Zn-finger protein   20.6      34 0.00074   33.9   0.1   17  266-286   308-324 (381)
128 PF14247 DUF4344:  Domain of un  20.4      65  0.0014   30.3   1.9   20   47-66     90-109 (220)
129 PRK14873 primosome assembly pr  20.1      70  0.0015   34.7   2.3   48  266-316   383-430 (665)

No 1  
>PF08325 WLM:  WLM domain;  InterPro: IPR013536 The WLM (WSS1-like metalloprotease) domain is a globular domain related to the zincin-like superfamily of Zn-dependent peptidase. Since the WLM domain contains all known active site residues of zincins, it is predicted to be a catalytically active peptidase domain. The WLM domain is a eukaryotic domain represented in plants, fungi, Plasmodium, and kinetoplastids. By contrast, it is absent in animals, Cryptosporidium, and Microsporidia, suggesting that it has been lost on multiple occasions during the evolution of eukaryotes. The WLM domain is found either in stand-alone form or in association with other domains such as the RanBP2 zinc finger , the ubiquitin domain, or the PUB/PUG domain. This domain could function as a specific de-SUMOylating domain of distinct protein complexes in the nucleus and the cytoplasm []. It has been suggested to form a segregated alpha/beta structure with eight helices and five strands. Proteins containign this domain include yeast WSS1 (a weak suppressor of the Ub-related protein SMT3), and various putative metalloproteases from plant and fungal species.
Probab=100.00  E-value=2.1e-42  Score=310.24  Aligned_cols=148  Identities=45%  Similarity=0.676  Sum_probs=131.0

Q ss_pred             CCCCCceeceecccccCC--ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChhHHHHHHHHHH
Q 038987            1 MRNHKWKVKLLSEMHSKN--ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAKFYKLWEELRE   78 (316)
Q Consensus         1 Mr~~~w~V~~L~Ef~P~~--lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~Fy~ll~~l~~   78 (316)
                      |++|+|+|++|+||||++  +||+|+|+|++|.||||++++ ..|+||+.|++|||||||||+|++||++||+++++|..
T Consensus        33 M~~~~~~V~~L~E~~P~~~~llG~N~N~G~~I~lrLR~~~~-~~fl~~~~i~~t~lHELaH~~~~~H~~~F~~l~~~l~~  111 (186)
T PF08325_consen   33 MRKHGWRVGSLEEFYPNGERLLGLNVNKGEKICLRLRTPDD-GGFLPYETILGTMLHELAHNVHGPHDDKFWKLLDELRK  111 (186)
T ss_pred             HHHcCcccCeeeccCCCCCCCcceecCCCcEEEEEeCCCCC-CCEeeHHHHHHHHHHHHHhcccCCccHHHHHHHHHHHH
Confidence            899999999999999998  999999999999999999988 89999999999999999999999999999999999999


Q ss_pred             HHHHHHhccccCCCcccCCCcccCCCCCCCCCCChhHHHHHHHHhhhhcCCCCCCCCcccCCCCCC----CCCCCHHHHH
Q 038987           79 ECDELRSKGITGVGSFDRPGRVLGGVSPQPPLSSLPQTALAAAEKRAHSNSLLPSGPKLLGGDRFV----MYDLSPVQAA  154 (316)
Q Consensus        79 e~~~l~~~G~~G~ggf~~~G~rLGG~~~~~p~~~~r~~al~aaekR~~~~~~~~~g~~~LGG~~~~----~~~~s~re~a  154 (316)
                      |++.|+++||+ + ||++.|++|||.....+         ...+.   ....+.+++++|||++..    .+..++||++
T Consensus       112 e~~~l~~~G~~-~-gf~~~G~~l~~~~~~~~---------~~~~~---~~~~~~~~~~~LgG~s~~~~~~~~~~~~Re~~  177 (186)
T PF08325_consen  112 ECEELDAKGYT-E-GFWSSGRRLGGSSGQPS---------EEREL---RGNGLSGGGQRLGGGSSSRPRKAQPKSPREAA  177 (186)
T ss_pred             HHHHHHhcCCc-c-ccCCCCcccCCCCcccc---------hhhhh---hccccCCCCeeCCCCCCCCCCcCCCcCHHHHH
Confidence            99999999999 6 89999999999765433         01111   112356778999998752    5689999999


Q ss_pred             HHHHHHHhh
Q 038987          155 AMAVEKRLQ  163 (316)
Q Consensus       155 a~AAerR~~  163 (316)
                      |+|||||++
T Consensus       178 a~AAerR~~  186 (186)
T PF08325_consen  178 AAAAERRLR  186 (186)
T ss_pred             HHHHHhhcC
Confidence            999999985


No 2  
>KOG4842 consensus Protein involved in sister chromatid separation and/or segregation [Cell cycle control, cell division, chromosome partitioning]
Probab=99.68  E-value=2.1e-17  Score=154.59  Aligned_cols=160  Identities=26%  Similarity=0.301  Sum_probs=121.5

Q ss_pred             CCCCCceeceecccccCC--ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChhHHHHHHHHHH
Q 038987            1 MRNHKWKVKLLSEMHSKN--ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAKFYKLWEELRE   78 (316)
Q Consensus         1 Mr~~~w~V~~L~Ef~P~~--lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~Fy~ll~~l~~   78 (316)
                      |++|+|.|-.+.++++.+  +||+|||.|.+|.|+||...+..+|+|++++..|++|||+|++.+||+++||+.|+.|..
T Consensus        62 mkEh~f~vti~~Dk~irnq~~sg~nvn~gski~lslr~~~~e~~~lp~e~pmgtylhel~h~lqgPhd~rfl~~L~~Lra  141 (278)
T KOG4842|consen   62 MKEHHFKVTILVDKYIRNQRLSGMNVNHGSKIMLSLRCSTDEFQFLPMECPMGTYLHELTHNLQGPHDKRFLNKLDELRA  141 (278)
T ss_pred             hccccceeEEeehhHHHhhhhhccccCCcceEEEEeeccccccccccccccchhhhhhhhhhhcCCChHHHHHHHHHHhh
Confidence            899999999999999998  999999999999999996666778999999999999999999999999999999999999


Q ss_pred             HHHHHHhccccCCCcccCCCcccCCCCCCCCCCChhHHHHHHHHhhhhcCCCCCCCCcccCCC-------------CCCC
Q 038987           79 ECDELRSKGITGVGSFDRPGRVLGGVSPQPPLSSLPQTALAAAEKRAHSNSLLPSGPKLLGGD-------------RFVM  145 (316)
Q Consensus        79 e~~~l~~~G~~G~ggf~~~G~rLGG~~~~~p~~~~r~~al~aaekR~~~~~~~~~g~~~LGG~-------------~~~~  145 (316)
                      +--.+..+|+.-  -|.+-+..|||...-.- .  +...+..        +. ..|...|++.             +++.
T Consensus       142 d~gii~~mg~hr--W~vg~l~el~g~~nt~v-~--~~~tLg~--------st-nqG~i~lrlrtdrkkgfR~y~tissTl  207 (278)
T KOG4842|consen  142 DQGIIEQMGLHR--WFVGNLQELGGRANTRV-N--RYPTLGI--------ST-NQGVIVLRLRTDRKKGFRHYETISSTL  207 (278)
T ss_pred             chhHHHHhcccc--eechhhhhcccccceee-c--Cccceee--------cc-ccceEEEecccchhcccccCCCchHHH
Confidence            999998887643  36667788887532100 0  0000000        00 1111222221             1122


Q ss_pred             CCCCHHHHHHHHHHHHhhhcccccCCccc
Q 038987          146 YDLSPVQAAAMAVEKRLQYDLWCASQDLV  174 (316)
Q Consensus       146 ~~~s~re~aa~AAerR~~d~k~C~s~~~~  174 (316)
                      ....+|+.+++++|++.+.+.||+.....
T Consensus       208 ~heLtr~v~~ehde~fyrLdrql~kek~~  236 (278)
T KOG4842|consen  208 RHELTREVAAEHDERFYRLDRQLGKEKNN  236 (278)
T ss_pred             HhhhhhhHhhhhhhHHHHHHHHhCcccch
Confidence            24557899999999999999999986544


No 3  
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=99.56  E-value=2.8e-15  Score=132.90  Aligned_cols=61  Identities=28%  Similarity=0.382  Sum_probs=56.8

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChhHHHHHHHHHHHHHHHHh
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAKFYKLWEELREECDELRS   85 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~Fy~ll~~l~~e~~~l~~   85 (316)
                      .||.| +....|.|++|..     ++|.+.|+|||+|||||++|+||+++||+++.+++|+|++...
T Consensus       140 rWGsc-~~~~~I~ln~~L~-----~~P~~~idYVvvHEL~Hl~~~nHs~~Fw~~v~~~~Pd~k~~~~  200 (205)
T PF01863_consen  140 RWGSC-SSKGNITLNWRLV-----MAPPEVIDYVVVHELCHLRHPNHSKRFWALVEKYMPDYKERRK  200 (205)
T ss_pred             ccccC-CCCCcEEeecccc-----cCCccHHHHHHHHHHHHhccCCCCHHHHHHHHHHCcCHHHHHH
Confidence            89999 6555999999996     8999999999999999999999999999999999999998864


No 4  
>COG1451 Predicted metal-dependent hydrolase [General function prediction only]
Probab=99.25  E-value=3.6e-12  Score=117.78  Aligned_cols=61  Identities=25%  Similarity=0.351  Sum_probs=57.4

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChhHHHHHHHHHHHHHHHHh
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAKFYKLWEELREECDELRS   85 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~Fy~ll~~l~~e~~~l~~   85 (316)
                      .||.+.-+| .|.|+++..     .+|.+.|+||++|||||+.++||+++||+++..++|+|+++..
T Consensus       151 ~WGScs~~~-~i~~~~~l~-----~~p~~~i~YVvvHELaHLke~nHs~~Fw~lv~~~~P~~~~~~~  211 (223)
T COG1451         151 RWGSCSKAG-EIRFNWRLV-----MAPEEVIDYVVVHELAHLKEKNHSKRFWRLVEKYMPDYRAAKR  211 (223)
T ss_pred             eeeeecCCC-cEEeehhhh-----cCCHHHHHHHHHHHHHHHhhhhccHHHHHHHHHHCCChHHHHH
Confidence            899888888 999999987     5999999999999999999999999999999999999998865


No 5  
>KOG4842 consensus Protein involved in sister chromatid separation and/or segregation [Cell cycle control, cell division, chromosome partitioning]
Probab=99.24  E-value=4.6e-12  Score=118.96  Aligned_cols=85  Identities=29%  Similarity=0.414  Sum_probs=79.1

Q ss_pred             CCCCCceeceecccccCC--------ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChhHHHH
Q 038987            1 MRNHKWKVKLLSEMHSKN--------ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAKFYKL   72 (316)
Q Consensus         1 Mr~~~w~V~~L~Ef~P~~--------lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~Fy~l   72 (316)
                      |-.|.|.|+.|+|+.|..        +||+|.|.| .|.+|||++... .|+.|+.|-.|+.|||+|+++.-|+..||.+
T Consensus       149 mg~hrW~vg~l~el~g~~nt~v~~~~tLg~stnqG-~i~lrlrtdrkk-gfR~y~tissTl~heLtr~v~~ehde~fyrL  226 (278)
T KOG4842|consen  149 MGLHRWFVGNLQELGGRANTRVNRYPTLGISTNQG-VIVLRLRTDRKK-GFRHYETISSTLRHELTREVAAEHDERFYRL  226 (278)
T ss_pred             hcccceechhhhhcccccceeecCccceeeccccc-eEEEecccchhc-ccccCCCchHHHHhhhhhhHhhhhhhHHHHH
Confidence            567999999999999985        799999999 999999998655 5999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcc
Q 038987           73 WEELREECDELRSKG   87 (316)
Q Consensus        73 l~~l~~e~~~l~~~G   87 (316)
                      -.++-+|-..+++-+
T Consensus       227 drql~kek~~ad~~~  241 (278)
T KOG4842|consen  227 DRQLGKEKNNADQII  241 (278)
T ss_pred             HHHhCcccchhhhhc
Confidence            999999999998754


No 6  
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=98.06  E-value=1.7e-06  Score=74.67  Aligned_cols=58  Identities=22%  Similarity=0.318  Sum_probs=47.2

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCC------CCChhHHHHHHHHHHHH
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIA------PHDAKFYKLWEELREEC   80 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~------~H~~~Fy~ll~~l~~e~   80 (316)
                      .+|....+...|.|+.+...    -.|.+.|++||+|||||....      +|++.|++++.++...+
T Consensus        33 ~~G~~~~~~~~I~ln~~l~~----~~~~~~l~~~l~HEm~H~~~~~~g~~~~Hg~~f~~~~~~~~~~~   96 (146)
T smart00731       33 TGGRCLLKSAEIRLNPKLLT----ENGRDRLRETLLHELCHAALYLFGRGYGHGDEWKRWMRQVNGLF   96 (146)
T ss_pred             hhHHhhcCCCEEEeCHHHHh----hccHHHHHhhHHHHHHHHHHHHhCCCCCcCHHHHHHHHHHcCCC
Confidence            46766555668999977642    468899999999999999988      99999999999886543


No 7  
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=97.49  E-value=5.1e-05  Score=49.26  Aligned_cols=24  Identities=25%  Similarity=0.450  Sum_probs=19.9

Q ss_pred             CceeeccCCcccCcCccccccCCC
Q 038987          293 RVWTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       293 ~~WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      ..|.|..|||.|......|.+|++
T Consensus         3 g~W~C~~C~~~N~~~~~~C~~C~~   26 (30)
T PF00641_consen    3 GDWKCPSCTFMNPASRSKCVACGA   26 (30)
T ss_dssp             SSEEETTTTEEEESSSSB-TTT--
T ss_pred             cCccCCCCcCCchHHhhhhhCcCC
Confidence            479999999999999999999985


No 8  
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=97.19  E-value=0.00024  Score=60.84  Aligned_cols=58  Identities=24%  Similarity=0.318  Sum_probs=44.2

Q ss_pred             ccccccCCcc---EEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCC--------CCCChhHHHHHHHHHHHH
Q 038987           19 ALGSNLGAGV---HIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDI--------APHDAKFYKLWEELREEC   80 (316)
Q Consensus        19 lLGlN~N~G~---~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~--------~~H~~~Fy~ll~~l~~e~   80 (316)
                      .+|...-.+.   .|.|+.....    ..|.+.|..||+|||||...        .+|++.|..++.++...+
T Consensus        31 ~~G~~~~~~~~~~~I~ls~~~~~----~~~~~~~~~tL~HEm~H~~~~~~~~~~~~~Hg~~fk~~~~~ig~~~   99 (157)
T PF10263_consen   31 TAGRCRYKRRSPCEIRLSPKLLD----RNPEEELIDTLLHEMAHAAAYVFGGGRRRGHGKEFKQWARRIGASP   99 (157)
T ss_pred             ceEEEEECCCCceEEEECHHHHH----hhHHHHHHHHHHHHHHHHHhhhccCCCCCCCCHHHHHHHHHHCCcc
Confidence            5565444444   6777766643    37889999999999999877        799999999998886544


No 9  
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=97.06  E-value=0.00023  Score=44.51  Aligned_cols=23  Identities=26%  Similarity=0.483  Sum_probs=21.3

Q ss_pred             ceeeccCCcccCcCccccccCCC
Q 038987          294 VWTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       294 ~WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      .|.|..||+.|......|.+|++
T Consensus         2 ~W~C~~C~~~N~~~~~~C~~C~~   24 (26)
T smart00547        2 DWECPACTFLNFASRSKCFACGA   24 (26)
T ss_pred             cccCCCCCCcChhhhccccccCC
Confidence            59999999999999999999985


No 10 
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=96.61  E-value=0.00073  Score=43.82  Aligned_cols=22  Identities=32%  Similarity=0.872  Sum_probs=17.2

Q ss_pred             CccccCcceeccCC----CCCCCCCC
Q 038987          265 AMWECKACTFLNHG----CGSVPHQG  286 (316)
Q Consensus       265 ~~W~C~~CTllN~~----C~~C~rPr  286 (316)
                      ..|.|+.||++|++    |..|..|+
T Consensus         3 g~W~C~~C~~~N~~~~~~C~~C~~~r   28 (30)
T PF00641_consen    3 GDWKCPSCTFMNPASRSKCVACGAPR   28 (30)
T ss_dssp             SSEEETTTTEEEESSSSB-TTT--BT
T ss_pred             cCccCCCCcCCchHHhhhhhCcCCCC
Confidence            58999999999999    98887765


No 11 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=96.26  E-value=0.0021  Score=40.07  Aligned_cols=21  Identities=48%  Similarity=0.993  Sum_probs=18.7

Q ss_pred             CccccCcceeccCC----CCCCCCC
Q 038987          265 AMWECKACTFLNHG----CGSVPHQ  285 (316)
Q Consensus       265 ~~W~C~~CTllN~~----C~~C~rP  285 (316)
                      +.|.|+.||++|.+    |..|..|
T Consensus         1 g~W~C~~C~~~N~~~~~~C~~C~~p   25 (26)
T smart00547        1 GDWECPACTFLNFASRSKCFACGAP   25 (26)
T ss_pred             CcccCCCCCCcChhhhccccccCCc
Confidence            36999999999999    9999876


No 12 
>PRK04351 hypothetical protein; Provisional
Probab=95.78  E-value=0.0094  Score=52.47  Aligned_cols=45  Identities=29%  Similarity=0.530  Sum_probs=32.6

Q ss_pred             cEEEEeeecCCCCCCCCChHHHHHHHHHHhhhc------C-CCCCChhHHHHHHHH
Q 038987           28 VHIKLLLRKLNRDRESLPFHEVLDTMLHELCHN------D-IAPHDAKFYKLWEEL   76 (316)
Q Consensus        28 ~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~------~-~~~H~~~Fy~ll~~l   76 (316)
                      ..|.|+-..-    .-.+.+.|..||.|||||+      . +.+|+++|..++.++
T Consensus        44 ~~I~lnp~ll----~~~~~~~l~~vv~HElcH~~~~~~g~g~~h~g~~fk~~~~~v   95 (149)
T PRK04351         44 HHIEFNPKML----EEYGLEELIGIIKHELCHYHLHLEGKGYQHRDRDFKELLKQV   95 (149)
T ss_pred             CeEEeCHHHH----hhccHHHHHhhHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHh
Confidence            3566654432    1245789999999999998      3 567899998887765


No 13 
>PRK04860 hypothetical protein; Provisional
Probab=94.50  E-value=0.025  Score=50.45  Aligned_cols=33  Identities=24%  Similarity=0.300  Sum_probs=26.9

Q ss_pred             CChHHHHHHHHHHhhhcCC-------CCCChhHHHHHHHH
Q 038987           44 LPFHEVLDTMLHELCHNDI-------APHDAKFYKLWEEL   76 (316)
Q Consensus        44 lP~~~I~~vllHELaH~~~-------~~H~~~Fy~ll~~l   76 (316)
                      .+.+.|..||.|||||++-       .+|+++|-.++.++
T Consensus        58 ~~~~~l~~~v~HEl~H~~~~~~~g~~~~Hg~ewk~lm~~v   97 (160)
T PRK04860         58 NQQAFIDEVVPHELAHLLVYQLFGRVAPHGKEWQWMMESV   97 (160)
T ss_pred             CcHHHHHhHHHHHHHHHHHHHHcCCCCCCCHHHHHHHHHh
Confidence            4678999999999999752       38999888887764


No 14 
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=94.49  E-value=0.033  Score=49.58  Aligned_cols=31  Identities=23%  Similarity=0.341  Sum_probs=26.1

Q ss_pred             hHHHHHHHHHHhhhcC-------CCCCChhHHHHHHHH
Q 038987           46 FHEVLDTMLHELCHND-------IAPHDAKFYKLWEEL   76 (316)
Q Consensus        46 ~~~I~~vllHELaH~~-------~~~H~~~Fy~ll~~l   76 (316)
                      .+.|+.||.|||||+.       +.+||.+|..+|.++
T Consensus        58 ~~f~~~vV~HELaHl~ly~~~gr~~phg~ewk~lm~qV   95 (156)
T COG3091          58 EDFIEQVVPHELAHLHLYQEFGRYKPHGKEWKLLMQQV   95 (156)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCCCCCCchhHHHHHHHh
Confidence            3578999999999985       569999998888765


No 15 
>KOG4345 consensus NF-kappa B regulator AP20/Cezanne [Signal transduction mechanisms]
Probab=93.19  E-value=0.03  Score=59.65  Aligned_cols=23  Identities=9%  Similarity=0.112  Sum_probs=21.7

Q ss_pred             ceeeccCCcccCcCccccccCCC
Q 038987          294 VWTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       294 ~WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      +|.|-.||++|+....+|.+|++
T Consensus       185 eW~~lik~ass~pr~~r~~~~~~  207 (774)
T KOG4345|consen  185 EWTELIKLASSEPRMHRSGNGGT  207 (774)
T ss_pred             HHHHHHHhhcccchhhhcccCCC
Confidence            49999999999999999999975


No 16 
>PF12773 DZR:  Double zinc ribbon
Probab=92.38  E-value=0.11  Score=36.72  Aligned_cols=46  Identities=17%  Similarity=0.259  Sum_probs=38.0

Q ss_pred             cCcceeccCC----CCCCCCCCCCCCCCCceeeccCCcccCcCccccccCC
Q 038987          269 CKACTFLNHG----CGSVPHQGDASANDRVWTCKFWTLENCVKLDKCSRVS  315 (316)
Q Consensus       269 C~~CTllN~~----C~~C~rPr~~~~~~~~WsC~~CT~~N~~~~~~C~~C~  315 (316)
                      |+.|-..|+.    |..|..+.. ......+.|+.|...|......|.-||
T Consensus         1 Cp~Cg~~~~~~~~fC~~CG~~l~-~~~~~~~~C~~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen    1 CPHCGTPNPDDAKFCPHCGTPLP-PPDQSKKICPNCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CCCcCCcCCccccCChhhcCChh-hccCCCCCCcCCcCCCcCCcCccCccc
Confidence            7888888888    888876654 234557999999999999999999997


No 17 
>KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only]
Probab=92.10  E-value=0.13  Score=49.88  Aligned_cols=23  Identities=22%  Similarity=0.532  Sum_probs=21.7

Q ss_pred             ceeeccCCcccCcCccccccCCC
Q 038987          294 VWTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       294 ~WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      .|.|+.|+|.|-.+...|-.|+.
T Consensus       140 DW~Cp~C~fhNfarn~~C~rC~~  162 (280)
T KOG4198|consen  140 DWECPGCNFHNFARNSECFRCGA  162 (280)
T ss_pred             CcccCCCCceeccccchhhhcCC
Confidence            69999999999999999999984


No 18 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=91.00  E-value=0.3  Score=38.32  Aligned_cols=58  Identities=21%  Similarity=0.072  Sum_probs=35.1

Q ss_pred             ccccccCC--ccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChhHHHHHHHHHHHHHHHH
Q 038987           19 ALGSNLGA--GVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAKFYKLWEELREECDELR   84 (316)
Q Consensus        19 lLGlN~N~--G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~Fy~ll~~l~~e~~~l~   84 (316)
                      +.|.....  ...|.|+-+        ++...-..+++|||.|.....+...+.........+..+..
T Consensus        18 ~~~~~~~~~~~~~I~in~~--------~~~~~~~f~laHELgH~~~~~~~~~~~~~~~~~~~~~~E~~   77 (122)
T PF06114_consen   18 LGGFSIPKENNPIIFINSN--------LSPERQRFTLAHELGHILLHHGDETFNYYLNYFFNERQERE   77 (122)
T ss_dssp             EEEETT----TTEEEEESS--------S-HHHHHHHHHHHHHHHHHHH-HHHHHHHHHH--THHHHHH
T ss_pred             cCEEEEecCcCCEEEECCC--------CCHHHHHHHHHHHHHHHHhhhccccchhhccccchhhHHHH
Confidence            55555443  567877755        34577789999999999998888765444444443333333


No 19 
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=90.27  E-value=0.27  Score=45.85  Aligned_cols=58  Identities=22%  Similarity=0.181  Sum_probs=41.1

Q ss_pred             CceeceecccccCC-ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCCh
Q 038987            5 KWKVKLLSEMHSKN-ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDA   67 (316)
Q Consensus         5 ~w~V~~L~Ef~P~~-lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~   67 (316)
                      .|+|.....=.|+. -+|.+.+.| .|-|.--.-.    .+..++|..||.||++|.++++.=.
T Consensus       117 ~~~v~i~~~~~~NAFa~g~~~~~~-~V~vt~gLl~----~l~~dEl~aVlaHElgHi~~rd~~~  175 (302)
T COG0501         117 MPEVYILETPQPNAFALGGGPKNG-RVVVTTGLLD----LLNDDELEAVLAHELGHIKNRHTLV  175 (302)
T ss_pred             CCeeEEecCCCccceecCCCCCCe-eEEecHHHHh----hCCHHHHHHHHHHHHHHHhcccHHH
Confidence            35566666555655 667665545 6766655542    6888999999999999999986653


No 20 
>PRK03001 M48 family peptidase; Provisional
Probab=89.57  E-value=0.32  Score=46.29  Aligned_cols=41  Identities=27%  Similarity=0.245  Sum_probs=29.2

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCC
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~   64 (316)
                      ..|.+.+++ .|.|.--.-.    .++.++|..||.|||+|++|++
T Consensus        99 a~G~~~~~~-~Ivvt~gLl~----~l~~~El~aVlAHElgHi~~~h  139 (283)
T PRK03001         99 ATGRNPEHA-AVAATTGILR----VLSEREIRGVMAHELAHVKHRD  139 (283)
T ss_pred             EecCCCCCe-EEEecHHHHh----hCCHHHHHHHHHHHHHHHhCCC
Confidence            667766555 4555433321    3578999999999999999874


No 21 
>PRK04897 heat shock protein HtpX; Provisional
Probab=89.53  E-value=0.31  Score=46.96  Aligned_cols=43  Identities=19%  Similarity=0.118  Sum_probs=30.3

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCC
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHD   66 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~   66 (316)
                      ..|.+.+++ .|.+.--.-    ..++.++|..||.|||+|++|++.-
T Consensus       112 a~G~~~~~~-~v~vt~gLl----~~l~~~El~aVlAHElgHi~~~d~~  154 (298)
T PRK04897        112 ATGSSPKNA-AVAVTTGLL----AIMNREELEGVIGHEISHIRNYDIR  154 (298)
T ss_pred             EeccCCCCc-EEEeehHHH----hhCCHHHHHHHHHHHHHHHhcCCHH
Confidence            667766555 455553222    1467899999999999999977653


No 22 
>PRK02870 heat shock protein HtpX; Provisional
Probab=89.17  E-value=0.4  Score=47.39  Aligned_cols=53  Identities=25%  Similarity=0.229  Sum_probs=33.7

Q ss_pred             eeceecccccCC-ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCC
Q 038987            7 KVKLLSEMHSKN-ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus         7 ~V~~L~Ef~P~~-lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~   64 (316)
                      +|..+..=.|+. .+|.+...+ .|.|.--.-    ..++.++|..||.|||+|++|++
T Consensus       135 ~V~vi~~~~~NAFA~G~~~~~~-~Ivvt~GLL----~~L~~dEL~aVlAHELgHik~~d  188 (336)
T PRK02870        135 KVYIIDAPYMNAFASGYSEKSA-MVAITTGLL----EKLDRDELQAVMAHELSHIRHGD  188 (336)
T ss_pred             eEEEEcCCCCceEEecCCCCCc-EEEEehHHh----hhCCHHHHHHHHHHHHHHHHccc
Confidence            333333333444 678775544 565543332    24688999999999999997754


No 23 
>PRK03982 heat shock protein HtpX; Provisional
Probab=87.84  E-value=0.5  Score=45.08  Aligned_cols=45  Identities=20%  Similarity=0.127  Sum_probs=30.9

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChh
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~   68 (316)
                      .+|.+.+++ .|.|.--..    ..++.++|..||.|||.|++|++.-..
T Consensus       100 a~G~~~~~~-~V~vt~gLl----~~l~~~El~AVlAHElgHi~~~h~~~~  144 (288)
T PRK03982        100 ATGRDPKHA-VVAVTEGIL----NLLNEDELEGVIAHELTHIKNRDTLIQ  144 (288)
T ss_pred             EeccCCCCe-EEEeehHHH----hhCCHHHHHHHHHHHHHHHHcCCHHHH
Confidence            667665444 454433332    246789999999999999999875333


No 24 
>PF05569 Peptidase_M56:  BlaR1 peptidase M56;  InterPro: IPR008756 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M56 (clan M-). The predicted active site residues for members of this family occur in the motif HEXXH. The type example is BlaR1 peptidase from Bacillus licheniformis. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. 
Probab=87.49  E-value=0.86  Score=43.14  Aligned_cols=30  Identities=27%  Similarity=0.192  Sum_probs=23.2

Q ss_pred             CCChHHHHHHHHHHhhhcCCCCCChhHHHH
Q 038987           43 SLPFHEVLDTMLHELCHNDIAPHDAKFYKL   72 (316)
Q Consensus        43 flP~~~I~~vllHELaH~~~~~H~~~Fy~l   72 (316)
                      -++.+.+++++.|||+|+++++.=.+|...
T Consensus       190 ~~~~~el~~il~HEl~Hikr~D~~~~~l~~  219 (299)
T PF05569_consen  190 DLSEEELRAILLHELAHIKRRDLLWKLLAE  219 (299)
T ss_pred             ccCHHHHHHHHHHHHHHHHCCChHHHHHHH
Confidence            356688999999999999988765554433


No 25 
>COG4219 MecR1 Antirepressor regulating drug resistance, predicted signal transduction N-terminal membrane component [Transcription / Signal transduction mechanisms]
Probab=87.36  E-value=0.32  Score=48.15  Aligned_cols=23  Identities=35%  Similarity=0.355  Sum_probs=20.1

Q ss_pred             CCCChHHHHHHHHHHhhhcCCCC
Q 038987           42 ESLPFHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        42 ~flP~~~I~~vllHELaH~~~~~   64 (316)
                      .-++.+.++|+++|||+|+++++
T Consensus       183 ~r~~~ee~~yIilHEl~Hlk~gD  205 (337)
T COG4219         183 ERLTDEELKYIILHELSHLKRGD  205 (337)
T ss_pred             hhcCHHhhhhhHhHHHhhhhccc
Confidence            35778899999999999999875


No 26 
>KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription]
Probab=87.29  E-value=0.34  Score=44.75  Aligned_cols=25  Identities=28%  Similarity=0.785  Sum_probs=14.9

Q ss_pred             CCCCCCCccccCcceeccCC----CCCCC
Q 038987          259 HNPEEPAMWECKACTFLNHG----CGSVP  283 (316)
Q Consensus       259 ~~~~~~~~W~C~~CTllN~~----C~~C~  283 (316)
                      .+......|.|..|||.|..    |.+|.
T Consensus        17 kp~~Deg~WdCsvCTFrNsAeAfkC~vCd   45 (228)
T KOG4477|consen   17 KPNDDEGKWDCSVCTFRNSAEAFKCFVCD   45 (228)
T ss_pred             CCccccCceeeeeeeecchhhhhheeeec
Confidence            33445556666666666666    66663


No 27 
>PRK05457 heat shock protein HtpX; Provisional
Probab=87.04  E-value=0.56  Score=45.05  Aligned_cols=41  Identities=20%  Similarity=0.238  Sum_probs=29.1

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCC
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~   64 (316)
                      ..|.+.+++ .|.+..-.-    ..++.++|..||.|||.|+++++
T Consensus       109 a~G~~~~~~-~V~vt~gLl----~~L~~~El~aVlAHElgHi~~~d  149 (284)
T PRK05457        109 ATGASKNNS-LVAVSTGLL----QNMSRDEVEAVLAHEISHIANGD  149 (284)
T ss_pred             EecCCCCCe-EEEeehHHh----hhCCHHHHHHHHHHHHHHHHcCC
Confidence            567665554 454443222    14688999999999999999975


No 28 
>PRK01345 heat shock protein HtpX; Provisional
Probab=86.97  E-value=0.54  Score=45.88  Aligned_cols=41  Identities=29%  Similarity=0.263  Sum_probs=29.0

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCC
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~   64 (316)
                      ..|.+.+++ .|.|.--.-.    .++.++|..||.|||.|+++++
T Consensus        99 a~G~~~~~~-~V~vt~gLL~----~L~~dEL~aVlAHElgHi~~~d  139 (317)
T PRK01345         99 ATGRNPENA-AVAATTGLLQ----RLSPEEVAGVMAHELAHVKNRD  139 (317)
T ss_pred             EecCCCCCe-EEEechHHHh----hCCHHHHHHHHHHHHHHHHcCC
Confidence            567655444 5666543332    3677999999999999999755


No 29 
>KOG3931 consensus Uncharacterized conserved protein [Function unknown]
Probab=86.83  E-value=1.1  Score=45.26  Aligned_cols=65  Identities=20%  Similarity=0.227  Sum_probs=50.2

Q ss_pred             cccccC--CccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcC---------CCCCChhHHHHHHHHH-----------
Q 038987           20 LGSNLG--AGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHND---------IAPHDAKFYKLWEELR-----------   77 (316)
Q Consensus        20 LGlN~N--~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~---------~~~H~~~Fy~ll~~l~-----------   77 (316)
                      -|++.-  +|.-+.|||-.|  ....+|...+..|||||+-|-.         .+.|+++|-+.+..+.           
T Consensus        76 AGICsyeg~gg~csIRLSeP--LLkLRPRkDLVETLLHEMIHAYlFV~n~~~dr~GHGP~F~~hMhrIN~~~GtNITvYH  153 (484)
T KOG3931|consen   76 AGICSYEGKGGMCSIRLSEP--LLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGTNITVYH  153 (484)
T ss_pred             cceeeeccccceEEEEecch--hhccCchHHHHHHHHHHHHHHheeEecccccCCCCChHHHHHHHHHhhccCceeEEEe
Confidence            366654  466778888776  3558999999999999999953         3589999999988764           


Q ss_pred             ------HHHHHHHhc
Q 038987           78 ------EECDELRSK   86 (316)
Q Consensus        78 ------~e~~~l~~~   86 (316)
                            ++|+..+|+
T Consensus       154 tFHDEV~~Yr~HwWR  168 (484)
T KOG3931|consen  154 TFHDEVDEYRRHWWR  168 (484)
T ss_pred             echHHHHHHHhhhhh
Confidence                  567777774


No 30 
>PRK02391 heat shock protein HtpX; Provisional
Probab=85.69  E-value=0.69  Score=44.74  Aligned_cols=42  Identities=19%  Similarity=0.147  Sum_probs=29.1

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCC
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPH   65 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H   65 (316)
                      ..|.+.+++ .|.+.--.-    ..++.++++.||.|||+|+++++-
T Consensus       108 a~G~~~~~~-~V~vt~gLl----~~L~~~El~aVlaHElgHi~~~di  149 (296)
T PRK02391        108 ATGRSPKNA-VVCVTTGLM----RRLDPDELEAVLAHELSHVKNRDV  149 (296)
T ss_pred             EecCCCCCc-EEEecHHHH----hhCCHHHHHHHHHHHHHHHHcCCH
Confidence            567765544 455432221    246789999999999999998863


No 31 
>PF04450 BSP:  Peptidase of plants and bacteria;  InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [].
Probab=85.46  E-value=0.45  Score=43.94  Aligned_cols=57  Identities=16%  Similarity=0.149  Sum_probs=42.4

Q ss_pred             cEEEEeeecCCCCCC-CCChHHHHHHHHHHhhhcCC-CCCChhHHHHHHHHHHHHHHHHh
Q 038987           28 VHIKLLLRKLNRDRE-SLPFHEVLDTMLHELCHNDI-APHDAKFYKLWEELREECDELRS   85 (316)
Q Consensus        28 ~~I~LRLR~~~~~~~-flP~~~I~~vllHELaH~~~-~~H~~~Fy~ll~~l~~e~~~l~~   85 (316)
                      .+|.|+++....-.. -.....|..||.|||+|++. .+++..+.-|++.+ .||..+.+
T Consensus        74 ~~I~~S~~~i~~~~~~~~~~~Ei~Gvl~HE~~H~~Q~~~~~~~P~~liEGI-ADyVRl~a  132 (205)
T PF04450_consen   74 KEIHFSARYIAKYPADGDVRDEIIGVLYHEMVHCWQWDGRGTAPGGLIEGI-ADYVRLKA  132 (205)
T ss_pred             cEEEEeHHHHhhcccccchHHHHHHHHHHHHHHHhhcCCCCCCChhheecH-HHHHHHHc
Confidence            789999987642211 12236899999999999997 45889999988876 45666665


No 32 
>PRK03072 heat shock protein HtpX; Provisional
Probab=84.97  E-value=0.57  Score=44.99  Aligned_cols=25  Identities=24%  Similarity=0.046  Sum_probs=21.4

Q ss_pred             CCChHHHHHHHHHHhhhcCCCCCCh
Q 038987           43 SLPFHEVLDTMLHELCHNDIAPHDA   67 (316)
Q Consensus        43 flP~~~I~~vllHELaH~~~~~H~~   67 (316)
                      .++.++|..||.|||+|+++++--.
T Consensus       121 ~l~~~El~aVlAHElgHi~~~d~~~  145 (288)
T PRK03072        121 ILNERELRGVLGHELSHVYNRDILI  145 (288)
T ss_pred             hCCHHHHHHHHHHHHHHHhcCCHHH
Confidence            5688999999999999999876543


No 33 
>KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only]
Probab=83.62  E-value=0.86  Score=44.26  Aligned_cols=53  Identities=21%  Similarity=0.451  Sum_probs=36.3

Q ss_pred             CCCCccccCcceeccCC----CCCCCCCCCCC---------CCCCceeeccCCcccCcCccccccC
Q 038987          262 EEPAMWECKACTFLNHG----CGSVPHQGDAS---------ANDRVWTCKFWTLENCVKLDKCSRV  314 (316)
Q Consensus       262 ~~~~~W~C~~CTllN~~----C~~C~rPr~~~---------~~~~~WsC~~CT~~N~~~~~~C~~C  314 (316)
                      -..+.|.|+.|+|+|-.    |--|..++...         .....|.++-+-.-+.....-|..|
T Consensus       136 ~~~GDW~Cp~C~fhNfarn~~C~rC~~~r~~~a~~~~~~s~~~~~~~~s~~~~~~~~t~~~~~~r~  201 (280)
T KOG4198|consen  136 WRSGDWECPGCNFHNFARNSECFRCGAKRPLAALLGNQASEATEHDWLSKVADSSSSTRFESLLRC  201 (280)
T ss_pred             ccccCcccCCCCceeccccchhhhcCCcCcccccccccccccccccccccccccccceecccchhh
Confidence            35579999999999999    77775554331         2445688888776655555555544


No 34 
>PRK01265 heat shock protein HtpX; Provisional
Probab=83.41  E-value=1.2  Score=44.00  Aligned_cols=42  Identities=29%  Similarity=0.252  Sum_probs=29.6

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCC
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPH   65 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H   65 (316)
                      ..|.+... ..|.|.--.-    ..++.++|..||.|||.|++|++=
T Consensus       115 a~G~~~~~-~~Ivvt~gLl----~~l~~~El~aVlAHElgHik~~d~  156 (324)
T PRK01265        115 AYGSPIAG-KRIAITLPLL----KILNRDEIKAVAGHELGHLKHRDV  156 (324)
T ss_pred             EeccCCCC-CEEEEehHHH----hhCCHHHHHHHHHHHHHHHHcccH
Confidence            45655444 3566654443    257889999999999999987654


No 35 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=83.41  E-value=0.98  Score=35.65  Aligned_cols=24  Identities=17%  Similarity=-0.018  Sum_probs=19.2

Q ss_pred             CChHHHHHHHHHHhhhcCCCCCCh
Q 038987           44 LPFHEVLDTMLHELCHNDIAPHDA   67 (316)
Q Consensus        44 lP~~~I~~vllHELaH~~~~~H~~   67 (316)
                      .+.+.+..|++|||+|.+++....
T Consensus        20 ~~~~~~~~~l~HE~~H~~~~~~~~   43 (128)
T PF13485_consen   20 SDEDWLDRVLAHELAHQWFGNYFG   43 (128)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHcC
Confidence            556778899999999998775543


No 36 
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=83.37  E-value=0.9  Score=42.50  Aligned_cols=27  Identities=37%  Similarity=0.421  Sum_probs=23.3

Q ss_pred             CCChHHHHHHHHHHhhhcCCCCCChhH
Q 038987           43 SLPFHEVLDTMLHELCHNDIAPHDAKF   69 (316)
Q Consensus        43 flP~~~I~~vllHELaH~~~~~H~~~F   69 (316)
                      ..|...+..||+|||-|+.-++||..-
T Consensus       161 ~~~~~~~a~t~AHElGHnlGm~HD~~~  187 (244)
T cd04270         161 RVPTKESDLVTAHELGHNFGSPHDPDI  187 (244)
T ss_pred             ccchhHHHHHHHHHHHHhcCCCCCCCC
Confidence            456667889999999999999999864


No 37 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=82.82  E-value=0.64  Score=41.19  Aligned_cols=44  Identities=27%  Similarity=0.175  Sum_probs=31.6

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChh
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~   68 (316)
                      .+|.+.  +..|.|....-    ..++.+.+..||.|||+|+.+++.-..
T Consensus        65 ~~g~~~--~~~I~v~~~ll----~~~~~~el~aVlaHElgH~~~~h~~~~  108 (226)
T PF01435_consen   65 ATGGGP--RKRIVVTSGLL----ESLSEDELAAVLAHELGHIKHRHILKS  108 (226)
T ss_dssp             EETTTC----EEEEEHHHH----HHSSHHHHHHHHHHHHHHHHTTHCCCC
T ss_pred             EEccCC--CcEEEEeChhh----hcccHHHHHHHHHHHHHHHHcCCcchH
Confidence            445443  44577766654    257889999999999999998877666


No 38 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=79.96  E-value=1.8  Score=40.46  Aligned_cols=42  Identities=19%  Similarity=0.146  Sum_probs=31.8

Q ss_pred             cccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChhH
Q 038987           22 SNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAKF   69 (316)
Q Consensus        22 lN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~F   69 (316)
                      .|-+.+..|.| .-     ..-++...+..||.|||=|++---|.+-|
T Consensus       112 s~G~P~~~I~I-~~-----~~~~~~~~~~hvi~HEiGH~IGfRHTD~~  153 (211)
T PF12388_consen  112 SNGNPYKFIQI-YG-----LSNYSVNVIEHVITHEIGHCIGFRHTDYF  153 (211)
T ss_pred             CCCCCCceEEE-Ee-----cCCCchhHHHHHHHHHhhhhccccccCcC
Confidence            34456678888 22     23567788999999999999999998733


No 39 
>PF08325 WLM:  WLM domain;  InterPro: IPR013536 The WLM (WSS1-like metalloprotease) domain is a globular domain related to the zincin-like superfamily of Zn-dependent peptidase. Since the WLM domain contains all known active site residues of zincins, it is predicted to be a catalytically active peptidase domain. The WLM domain is a eukaryotic domain represented in plants, fungi, Plasmodium, and kinetoplastids. By contrast, it is absent in animals, Cryptosporidium, and Microsporidia, suggesting that it has been lost on multiple occasions during the evolution of eukaryotes. The WLM domain is found either in stand-alone form or in association with other domains such as the RanBP2 zinc finger , the ubiquitin domain, or the PUB/PUG domain. This domain could function as a specific de-SUMOylating domain of distinct protein complexes in the nucleus and the cytoplasm []. It has been suggested to form a segregated alpha/beta structure with eight helices and five strands. Proteins containign this domain include yeast WSS1 (a weak suppressor of the Ub-related protein SMT3), and various putative metalloproteases from plant and fungal species.
Probab=78.47  E-value=6.7  Score=35.77  Aligned_cols=78  Identities=27%  Similarity=0.269  Sum_probs=51.2

Q ss_pred             HHHHHHHHHHhhhcCCCCCChhHHHHHHHHHHHHHHH-HhccccCCC-------------------cccCCCcccCCCCC
Q 038987           47 HEVLDTMLHELCHNDIAPHDAKFYKLWEELREECDEL-RSKGITGVG-------------------SFDRPGRVLGGVSP  106 (316)
Q Consensus        47 ~~I~~vllHELaH~~~~~H~~~Fy~ll~~l~~e~~~l-~~~G~~G~g-------------------gf~~~G~rLGG~~~  106 (316)
                      .....=|+| ..|--|..---++|+.|..-..+...- ..-|+.+.|                   ++.+.|++|||.+.
T Consensus        84 ~t~lHELaH-~~~~~H~~~F~~l~~~l~~e~~~l~~~G~~~gf~~~G~~l~~~~~~~~~~~~~~~~~~~~~~~~LgG~s~  162 (186)
T PF08325_consen   84 GTMLHELAH-NVHGPHDDKFWKLLDELRKECEELDAKGYTEGFWSSGRRLGGSSGQPSEERELRGNGLSGGGQRLGGGSS  162 (186)
T ss_pred             HHHHHHHHh-cccCCccHHHHHHHHHHHHHHHHHHhcCCccccCCCCcccCCCCcccchhhhhhccccCCCCeeCCCCCC
Confidence            455677778 458888888888887777666555553 101211111                   24567899999765


Q ss_pred             C----CCCCChhHHHHHHHHhhh
Q 038987          107 Q----PPLSSLPQTALAAAEKRA  125 (316)
Q Consensus       107 ~----~p~~~~r~~al~aaekR~  125 (316)
                      .    ......|+.+.+||++|.
T Consensus       163 ~~~~~~~~~~~Re~~a~AAerR~  185 (186)
T PF08325_consen  163 SRPRKAQPKSPREAAAAAAERRL  185 (186)
T ss_pred             CCCCcCCCcCHHHHHHHHHHhhc
Confidence            3    345668899999999985


No 40 
>KOG3854 consensus SPRT-like metalloprotease [Function unknown]
Probab=78.36  E-value=1.4  Score=45.60  Aligned_cols=53  Identities=19%  Similarity=0.251  Sum_probs=35.2

Q ss_pred             ccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhc-------CCCCCChhHHHHHHHH---HHHHHHHHh
Q 038987           27 GVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHN-------DIAPHDAKFYKLWEEL---REECDELRS   85 (316)
Q Consensus        27 G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~-------~~~~H~~~Fy~ll~~l---~~e~~~l~~   85 (316)
                      -.+|.|.+.-      .-.-+.|..||+|||||.       .+..|++.|...=.+.   +||.-.+..
T Consensus       335 ~A~IeLs~kV------~tTAERir~TLiHEmCHaAaWv~dr~e~gHGd~wKrWa~ra~~~fPelP~i~~  397 (505)
T KOG3854|consen  335 YAKIELSDKV------CTTAERIRDTLIHEMCHAAAWVFDREELGHGDNWKRWAYRANMAFPELPIIER  397 (505)
T ss_pred             eeEEEehhhh------hhHHHHHHHHHHHHHHHHHHhhccccccCcchHHHHHHHHHhhcCCccchHHH
Confidence            3567776553      345588999999999995       2889999876544433   344444443


No 41 
>PF01447 Peptidase_M4:  Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ;  InterPro: IPR013856 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases that belong to the MEROPS peptidase family M4 (thermolysin family, clan MA(E)). The protein fold of the peptidase domain of thermolysin, is the type example for members of the clan MA. The thermolysin family is composed only of secreted eubacterial endopeptidases. The zinc-binding residues are H-142, H-146 and E-166, with E-143 acting as the catalytic residue. Thermolysin also contains 4 calcium-binding sites, which contribute to its unusual thermostability. The family also includes enzymes from a number of pathogens, including Legionella and Listeria, and the protein pseudolysin, all with a substrate specificity for an aromatic residue in the P1' position. Three-dimensional structure analysis has shown that the enzymes undergo a hinge-bend motion during catalysis. Pseudolysin has a broader specificity, acting on large molecules such as elastin and collagen, possibly due to its wider active site cleft []. This entry represents a domain found in peptidase M4 family members.; GO: 0004222 metalloendopeptidase activity; PDB: 3NQX_A 3NQZ_B 3NQY_B 1BQB_A 1U4G_A 1EZM_A 3DBK_A 1ESP_A 1NPC_A 1LND_E ....
Probab=76.95  E-value=1.7  Score=38.30  Aligned_cols=21  Identities=38%  Similarity=0.518  Sum_probs=16.6

Q ss_pred             CCCCChHHHHHHHHHHhhhcC
Q 038987           41 RESLPFHEVLDTMLHELCHND   61 (316)
Q Consensus        41 ~~flP~~~I~~vllHELaH~~   61 (316)
                      ..|.|+..-+.|+.|||+|-|
T Consensus       127 ~~f~~~~~~lDVvaHEltHGV  147 (150)
T PF01447_consen  127 QIFKPFASSLDVVAHELTHGV  147 (150)
T ss_dssp             SSBS-GGG-HHHHHHHHHHHH
T ss_pred             cccccCccccceeeecccccc
Confidence            369999998999999999965


No 42 
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup. The adamalysin_like or ADAM (A Disintegrin And Metalloprotease) family of metalloproteases are integral membrane proteases acting on a variety of extracellular targets. They are involved in shedding soluble peptides or proteins from the cell surface. This subfamily contains fungal ADAMs, whose precise function has yet to be determined.
Probab=75.16  E-value=1.1  Score=41.55  Aligned_cols=18  Identities=33%  Similarity=0.392  Sum_probs=16.6

Q ss_pred             HHHHHHhhhcCCCCCChh
Q 038987           51 DTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        51 ~vllHELaH~~~~~H~~~   68 (316)
                      .||+|||.|+.-++||..
T Consensus       147 ~t~AHElGHnLGm~HD~~  164 (228)
T cd04271         147 QVFAHEIGHTFGAVHDCT  164 (228)
T ss_pred             eehhhhhhhhcCCCCCCC
Confidence            699999999999999964


No 43 
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=69.62  E-value=2.6  Score=38.38  Aligned_cols=19  Identities=53%  Similarity=0.604  Sum_probs=17.6

Q ss_pred             HHHHHHHhhhcCCCCCChh
Q 038987           50 LDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        50 ~~vllHELaH~~~~~H~~~   68 (316)
                      ..||+|||.|+.-++||..
T Consensus       146 ~~~~AHElGH~lG~~HD~~  164 (220)
T cd04272         146 VYTMTHELAHLLGAPHDGS  164 (220)
T ss_pred             HHHHHHHHHHHhCCCCCCC
Confidence            6999999999999999965


No 44 
>COG4900 Predicted metallopeptidase [General function prediction only]
Probab=69.46  E-value=7.3  Score=33.60  Aligned_cols=48  Identities=27%  Similarity=0.389  Sum_probs=33.1

Q ss_pred             cCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCC------CCCC--hhHHHHHHH
Q 038987           24 LGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDI------APHD--AKFYKLWEE   75 (316)
Q Consensus        24 ~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~------~~H~--~~Fy~ll~~   75 (316)
                      .|.+-.|.|--..    ..-+|-+.=..||+|||.|+-.      .+|+  .+||....-
T Consensus        59 lnP~YviEl~sek----F~rLs~~ekvKviiHEllHIP~tfSGgLRaHg~~vn~rrv~kL  114 (133)
T COG4900          59 LNPVYVIELLSEK----FKRLSCAEKVKVIIHELLHIPATFSGGLRAHGPLVNFRRVYKL  114 (133)
T ss_pred             CCCeeeeeeehhh----cCCCChHHHHHHHHHHHhcCcccccCccccCCcchhHHHHHHH
Confidence            4666666653321    1247788888999999999975      3788  788865543


No 45 
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=67.62  E-value=2.8  Score=36.96  Aligned_cols=22  Identities=45%  Similarity=0.314  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHhhhcCCCCCChh
Q 038987           47 HEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        47 ~~I~~vllHELaH~~~~~H~~~   68 (316)
                      ...-.||+|||.|+.-..||..
T Consensus       131 ~~~~~~~aHElGH~lG~~HD~~  152 (192)
T cd04267         131 LLTALTMAHELGHNLGAEHDGG  152 (192)
T ss_pred             eeehhhhhhhHHhhcCCcCCCC
Confidence            3456799999999999999976


No 46 
>TIGR02414 pepN_proteo aminopeptidase N, Escherichia coli type. The M1 family of zinc metallopeptidases contains a number of distinct, well-separated clades of proteins with aminopeptidase activity. Several are designated aminopeptidase N, EC 3.4.11.2, after the Escherichia coli enzyme, suggesting a similar activity profile. This family consists of all aminopeptidases closely related to E. coli PepN and presumed to have similar (not identical) function. Nearly all are found in Proteobacteria, but members are found also in Cyanobacteria, plants, and apicomplexan parasites. This family differs greatly in sequence from the family of aminopeptidases typified by Streptomyces lividans PepN (TIGR02412), from the membrane bound aminopeptidase N family in animals, etc.
Probab=67.39  E-value=3.3  Score=45.80  Aligned_cols=20  Identities=20%  Similarity=0.330  Sum_probs=17.4

Q ss_pred             ChHHHHHHHHHHhhhcCCCC
Q 038987           45 PFHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        45 P~~~I~~vllHELaH~~~~~   64 (316)
                      .+..|..|+.|||+|.+.||
T Consensus       279 ~~~~i~~VIaHElaHqWfGN  298 (863)
T TIGR02414       279 DYERIESVIAHEYFHNWTGN  298 (863)
T ss_pred             HHHHHHHHHHHHHHHHHhcc
Confidence            35678999999999999995


No 47 
>PF13688 Reprolysin_5:  Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=67.27  E-value=3.5  Score=36.26  Aligned_cols=26  Identities=38%  Similarity=0.448  Sum_probs=16.7

Q ss_pred             CChHHHHHHHHHHhhhcCCCCCChhH
Q 038987           44 LPFHEVLDTMLHELCHNDIAPHDAKF   69 (316)
Q Consensus        44 lP~~~I~~vllHELaH~~~~~H~~~F   69 (316)
                      .+...-..|++|||.|+.-.+||..-
T Consensus       137 ~~~~~~~~~~AHEiGH~lGa~HD~~~  162 (196)
T PF13688_consen  137 PPTYNGAITFAHEIGHNLGAPHDGDY  162 (196)
T ss_dssp             --HHHHHHHHHHHHHHHTT-----SS
T ss_pred             CCCCceehhhHHhHHHhcCCCCCCCC
Confidence            45778889999999999999998653


No 48 
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=66.83  E-value=2.3  Score=34.53  Aligned_cols=16  Identities=50%  Similarity=0.582  Sum_probs=11.7

Q ss_pred             HHHHHHhhhcCCCCCC
Q 038987           51 DTMLHELCHNDIAPHD   66 (316)
Q Consensus        51 ~vllHELaH~~~~~H~   66 (316)
                      +|+.|||-|+.-.+||
T Consensus       109 ~~~~HEiGH~lGl~Hd  124 (124)
T PF13582_consen  109 DTFAHEIGHNLGLNHD  124 (124)
T ss_dssp             THHHHHHHHHTT----
T ss_pred             eEeeehhhHhcCCCCC
Confidence            9999999999999996


No 49 
>PF10026 DUF2268:  Predicted Zn-dependent protease (DUF2268);  InterPro: IPR018728  This domain, found in various hypothetical bacterial proteins, as well as predicted zinc dependent proteases, has no known function. 
Probab=65.58  E-value=5.7  Score=35.89  Aligned_cols=47  Identities=26%  Similarity=0.163  Sum_probs=31.2

Q ss_pred             cEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCCh---hHHHHHHHHHHH
Q 038987           28 VHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDA---KFYKLWEELREE   79 (316)
Q Consensus        28 ~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~---~Fy~ll~~l~~e   79 (316)
                      ..|.|-| .+.    -...+.|..+|+||+-|++...+-.   .=..|++.++-|
T Consensus        49 ~~i~l~~-~~~----~~~~~~l~~~iaHE~hH~~r~~~~~~~~~~~TLld~~I~E   98 (195)
T PF10026_consen   49 GYIFLFL-LPN----DYSLEELPALIAHEYHHNCRYEQIGWDPEDTTLLDSLIME   98 (195)
T ss_pred             CEEEEEe-cCC----cccHHHHHHHHHHHHHHHHHHhccCCCCCCCCHHHHHHHh
Confidence            4777776 432    3566799999999999997544322   334566666543


No 50 
>COG0308 PepN Aminopeptidase N [Amino acid transport and metabolism]
Probab=65.13  E-value=4  Score=45.01  Aligned_cols=23  Identities=22%  Similarity=0.335  Sum_probs=19.1

Q ss_pred             CCChHHHHHHHHHHhhhcCCCCC
Q 038987           43 SLPFHEVLDTMLHELCHNDIAPH   65 (316)
Q Consensus        43 flP~~~I~~vllHELaH~~~~~H   65 (316)
                      -..|+.|..|++|||+|++.||=
T Consensus       301 ~~~~~~~~~viaHElaHqWfGnl  323 (859)
T COG0308         301 DSDYENVEEVIAHELAHQWFGNL  323 (859)
T ss_pred             hHHHHHHHHHHHHHHhhhcccce
Confidence            34457888899999999999974


No 51 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=65.10  E-value=3.3  Score=26.01  Aligned_cols=22  Identities=14%  Similarity=0.090  Sum_probs=19.4

Q ss_pred             eeeccCCcccCcCccccccCCC
Q 038987          295 WTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       295 WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      +.|+.|..+|......|..||+
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCcccccChhhCC
Confidence            6799999999999999999985


No 52 
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=64.15  E-value=5.2  Score=35.37  Aligned_cols=23  Identities=39%  Similarity=0.290  Sum_probs=19.9

Q ss_pred             hHHHHHHHHHHhhhcCCCCCChh
Q 038987           46 FHEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~H~~~   68 (316)
                      +...-.|++|||.|+.-.+||..
T Consensus       128 ~~~~a~~~AHElGH~lG~~HD~~  150 (194)
T cd04269         128 LLLFAVTMAHELGHNLGMEHDDG  150 (194)
T ss_pred             hHHHHHHHHHHHHhhcCCCcCCC
Confidence            34557899999999999999987


No 53 
>PF14521 Aspzincin_M35:  Lysine-specific metallo-endopeptidase ; PDB: 2X3C_A 2X3A_A 2X3B_A 1GE7_B 1GE6_A 1GE5_A 1G12_A.
Probab=62.68  E-value=3.9  Score=35.57  Aligned_cols=39  Identities=15%  Similarity=0.095  Sum_probs=19.9

Q ss_pred             EEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCChhH
Q 038987           29 HIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDAKF   69 (316)
Q Consensus        29 ~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~~F   69 (316)
                      +|.|.-.--..+.  .-...-..||+|||+|+.-.-+..++
T Consensus        78 ~IyLc~~F~~~p~--~g~~Sk~~TLiHE~SHf~~~~~T~D~  116 (148)
T PF14521_consen   78 TIYLCPAFFSAPT--TGKDSKEGTLIHEWSHFTAVGGTDDY  116 (148)
T ss_dssp             EEEE-HHHHHS-S--SSTT-HHHHHHHHHHHSCCCT--B-S
T ss_pred             EEEEChhhcCCCC--CCCCchHHHHHHhhhhhhhhcCCCcc
Confidence            4666544322221  22345689999999997654444443


No 54 
>PRK14015 pepN aminopeptidase N; Provisional
Probab=61.64  E-value=3.9  Score=45.37  Aligned_cols=19  Identities=21%  Similarity=0.359  Sum_probs=16.6

Q ss_pred             hHHHHHHHHHHhhhcCCCC
Q 038987           46 FHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~   64 (316)
                      +..|..||+|||+|.++||
T Consensus       293 ~~~i~~vIaHElaHqWFGN  311 (875)
T PRK14015        293 YERIESVIAHEYFHNWTGN  311 (875)
T ss_pred             HHHHHHHHHHHHHHHHHhC
Confidence            4568999999999999995


No 55 
>PF13574 Reprolysin_2:  Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=60.66  E-value=4  Score=36.11  Aligned_cols=20  Identities=50%  Similarity=0.597  Sum_probs=15.1

Q ss_pred             HHHHHHHHhhhcCCCCCChh
Q 038987           49 VLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        49 I~~vllHELaH~~~~~H~~~   68 (316)
                      -.+|++|||.|+.-.+|+-.
T Consensus       111 ~~~~~aHElGH~lGa~Hd~~  130 (173)
T PF13574_consen  111 GIDTFAHELGHQLGAPHDFD  130 (173)
T ss_dssp             HHHHHHHHHHHHHT---SSS
T ss_pred             eeeeehhhhHhhcCCCCCCC
Confidence            55679999999999999988


No 56 
>COG5100 NPL4 Nuclear pore protein [Nuclear structure]
Probab=60.37  E-value=1.9  Score=44.17  Aligned_cols=23  Identities=26%  Similarity=0.507  Sum_probs=20.5

Q ss_pred             ceeeccCCcccCcCccccccCCC
Q 038987          294 VWTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       294 ~WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      .|-|+.|||.|...+-+|+||.+
T Consensus       546 ~we~~~~~~i~~~~~~t~~m~~~  568 (571)
T COG5100         546 RWECKMCTFINEKNSCTCEMCNS  568 (571)
T ss_pred             HHHHHHHHHhcccCceEEEeecc
Confidence            59999999999999999999963


No 57 
>PF01433 Peptidase_M1:  Peptidase family M1 This is family M1 in the peptidase classification.;  InterPro: IPR014782 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M1 (clan MA(E)), the type example being aminopeptidase N from Homo sapiens (Human). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA.  Membrane alanine aminopeptidase (3.4.11.2 from EC) is part of the HEXXH+E group; it consists entirely of aminopeptidases, spread across a wide variety of species []. Functional studies show that CD13/APN catalyzes the removal of single amino acids from the amino terminus of small peptides and probably plays a role in their final digestion; one family member (leukotriene-A4 hydrolase) is known to hydrolyse the epoxide leukotriene-A4 to form an inflammatory mediator []. This hydrolase has been shown to have aminopeptidase activity [], and the zinc ligands of the M1 family were identified by site-directed mutagenesis on this enzyme [] CD13 participates in trimming peptides bound to MHC class II molecules [] and cleaves MIP-1 chemokine, which alters target cell specificity from basophils to eosinophils []. CD13 acts as a receptor for specific strains of RNA viruses (coronaviruses) which cause a relatively large percentage of upper respiratory trace infections. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 2XQ0_A 2XPY_A 2XPZ_A 3SE6_B 3EBH_A 3EBG_A 3T8V_A 3Q44_A 3Q43_A 3EBI_A ....
Probab=59.46  E-value=6.9  Score=37.66  Aligned_cols=19  Identities=26%  Similarity=0.354  Sum_probs=16.9

Q ss_pred             hHHHHHHHHHHhhhcCCCC
Q 038987           46 FHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~   64 (316)
                      ...+..+|+|||||.++|+
T Consensus       292 ~~~~~~~iahElahqWfGn  310 (390)
T PF01433_consen  292 KQEIASLIAHELAHQWFGN  310 (390)
T ss_dssp             HHHHHHHHHHHHHTTTBTT
T ss_pred             hhhhHHHHHHHHHHHHhcc
Confidence            4578999999999999996


No 58 
>PF15639 Tox-MPTase3:  Metallopeptidase toxin 3
Probab=59.18  E-value=3.7  Score=35.88  Aligned_cols=34  Identities=29%  Similarity=0.178  Sum_probs=22.0

Q ss_pred             CccEEEEeeecCCCCCCCCC-------hHHHHHHHHHHhhhc
Q 038987           26 AGVHIKLLLRKLNRDRESLP-------FHEVLDTMLHELCHN   60 (316)
Q Consensus        26 ~G~~I~LRLR~~~~~~~flP-------~~~I~~vllHELaH~   60 (316)
                      ++++|.|+-.+..+.. .-|       +-.|..||||||.|-
T Consensus        71 ~~~~i~I~~~lV~~~E-k~~~~~r~~~~~~v~~TlLHEliHw  111 (135)
T PF15639_consen   71 GSQVIRIDGDLVNMFE-KGPGERRAGNVYLVGSTLLHELIHW  111 (135)
T ss_pred             CCcEEEeeHHHhhhhh-cCCcccccceEEEeehHHHHHHHHh
Confidence            5678877766554221 222       235778999999994


No 59 
>PF01421 Reprolysin:  Reprolysin (M12B) family zinc metalloprotease  This Prosite motif covers only the active site.;  InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=59.09  E-value=6.8  Score=34.81  Aligned_cols=25  Identities=32%  Similarity=0.262  Sum_probs=18.7

Q ss_pred             CChHHHHHHHHHHhhhcCCCCCChh
Q 038987           44 LPFHEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        44 lP~~~I~~vllHELaH~~~~~H~~~   68 (316)
                      ..+...-.+|+|||.|+.-++||..
T Consensus       126 ~~~~~~a~~~AHelGH~lGm~HD~~  150 (199)
T PF01421_consen  126 RSGLSFAVIIAHELGHNLGMPHDGD  150 (199)
T ss_dssp             SSHHHHHHHHHHHHHHHTT---TTT
T ss_pred             chhHHHHHHHHHHHHHhcCCCCCCC
Confidence            3456677999999999999999987


No 60 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=58.96  E-value=5.3  Score=24.69  Aligned_cols=21  Identities=14%  Similarity=0.108  Sum_probs=18.4

Q ss_pred             eeccCCcccCcCccccccCCC
Q 038987          296 TCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       296 sC~~CT~~N~~~~~~C~~C~~  316 (316)
                      .|+.|.-+|......|..||+
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~   21 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGT   21 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCC
Confidence            388999999999999999985


No 61 
>PRK15410 DgsA anti-repressor MtfA; Provisional
Probab=57.99  E-value=9.7  Score=36.71  Aligned_cols=62  Identities=15%  Similarity=0.182  Sum_probs=38.5

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCCh----------hHHHHHHHHH-HHHHHHHh
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDA----------KFYKLWEELR-EECDELRS   85 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~----------~Fy~ll~~l~-~e~~~l~~   85 (316)
                      ++|-...+| .|-|.+-....  .+.+ + =..|++||+||...+-++.          ..|.-|.+++ .+|+.+..
T Consensus       117 ~~GEaw~~G-pVVLSW~d~~~--~~~~-d-g~NVvIHEFAH~LDm~~G~~adG~PpL~~~~~~~W~~~~~~~~~~l~~  189 (260)
T PRK15410        117 QSGQSWQQG-PIVLNWLDIQD--SFDA-S-GFNLIIHEVAHKLDMRNGDRASGVPFIPLREVAGWEHDLHAAMNNIQE  189 (260)
T ss_pred             ccccCcCCC-cEEEEHHHhhc--ccCC-C-CcchhHhHHHhHhhhhcCCCCCCCCCCCchhHHHHHHHHHHHHHHHHH
Confidence            456566666 67787775321  2222 2 4689999999999988754          3445555443 55666643


No 62 
>PLN00162 transport protein sec23; Provisional
Probab=57.96  E-value=5.6  Score=43.37  Aligned_cols=35  Identities=26%  Similarity=0.655  Sum_probs=25.7

Q ss_pred             ccccCcc-eeccCCCCCCCCCCCCCCCCCceeeccCCcccCcC
Q 038987          266 MWECKAC-TFLNHGCGSVPHQGDASANDRVWTCKFWTLENCVK  307 (316)
Q Consensus       266 ~W~C~~C-TllN~~C~~C~rPr~~~~~~~~WsC~~CT~~N~~~  307 (316)
                      .=.|..| +|+||-|.. .      ...+.|.|.+|...|...
T Consensus        53 pvRC~~CraylNPf~~~-d------~~~~~W~C~~C~~~N~~P   88 (761)
T PLN00162         53 PLRCRTCRAVLNPYCRV-D------FQAKIWICPFCFQRNHFP   88 (761)
T ss_pred             CCccCCCcCEECCceEE-e------cCCCEEEccCCCCCCCCc
Confidence            3457777 588888876 2      134579999999999764


No 63 
>PF09768 Peptidase_M76:  Peptidase M76 family;  InterPro: IPR019165 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. Mitochondrial inner membrane protease ATP23 has two roles in the assembly of mitochondrial ATPase. Firstly, it acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side. Secondly, it is involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring [, ].; GO: 0004222 metalloendopeptidase activity
Probab=57.42  E-value=8.2  Score=34.98  Aligned_cols=19  Identities=32%  Similarity=0.281  Sum_probs=16.4

Q ss_pred             CCChHHHHHHHHHHhhhcC
Q 038987           43 SLPFHEVLDTMLHELCHND   61 (316)
Q Consensus        43 flP~~~I~~vllHELaH~~   61 (316)
                      +.....+..||.|||.|..
T Consensus        65 ~~~~~~l~~~l~HELIHay   83 (173)
T PF09768_consen   65 IRSQGHLEDTLTHELIHAY   83 (173)
T ss_pred             CCCHHHHHHHHHHHHHHHH
Confidence            4667899999999999964


No 64 
>PF02102 Peptidase_M35:  Deuterolysin metalloprotease (M35) family;  InterPro: IPR001384 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M35 (deuterolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Deuterolysin is a microbial zinc-containing metalloprotease that shows some similarity to thermolysin []. The protein is expressed with a possible 19-residue signal sequence, a 155-residue propeptide, and an active peptide of 177 residues []. The latter contains an HEXXH motif towards the C terminus, but the other zinc ligands are as yet undetermined [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 1EB6_A.
Probab=56.74  E-value=5.8  Score=39.83  Aligned_cols=20  Identities=30%  Similarity=0.486  Sum_probs=12.7

Q ss_pred             HHHHHHHHHhhhcC--CCCCCh
Q 038987           48 EVLDTMLHELCHND--IAPHDA   67 (316)
Q Consensus        48 ~I~~vllHELaH~~--~~~H~~   67 (316)
                      .-..|+||||+|+.  +.|+..
T Consensus       296 Dqatt~LHE~TH~~~V~~pgt~  317 (359)
T PF02102_consen  296 DQATTTLHEMTHAPAVYSPGTD  317 (359)
T ss_dssp             -HHHHHHHHHHT-TTTSSS--B
T ss_pred             CccchhhhhhhccccccCCCcc
Confidence            45689999999995  555554


No 65 
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.
Probab=56.24  E-value=2.9  Score=37.71  Aligned_cols=20  Identities=40%  Similarity=0.378  Sum_probs=18.0

Q ss_pred             HHHHHHHHhhhcCCCCCChh
Q 038987           49 VLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        49 I~~vllHELaH~~~~~H~~~   68 (316)
                      ...||.|||.|+.-.+||..
T Consensus       140 ~a~~~aHElGH~LG~~HD~~  159 (207)
T cd04273         140 SAFTIAHELGHVLGMPHDGD  159 (207)
T ss_pred             eEEeeeeechhhcCCCCCCC
Confidence            34899999999999999987


No 66 
>PF10460 Peptidase_M30:  Peptidase M30;  InterPro: IPR019501 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases [].  This family contains metallopeptidases belonging to MEROPS peptidase family M30 (hyicolysin family, clan MA). Hyicolysin has a zinc ion which is liganded by two histidine and one glutamate residue. 
Probab=56.17  E-value=7.9  Score=39.04  Aligned_cols=41  Identities=15%  Similarity=-0.065  Sum_probs=27.1

Q ss_pred             ccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCC
Q 038987           23 NLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        23 N~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~   64 (316)
                      ..|.+..+.|........ ...-.+.+..||+||+-|+++-+
T Consensus       114 ~SNe~e~~YiD~~~~~~~-~~~~~~~~~sTlAHEfQHmInfy  154 (366)
T PF10460_consen  114 YSNESEYFYIDSETLYLG-GNSGPDTVYSTLAHEFQHMINFY  154 (366)
T ss_pred             CCcceeEEEEecHHhhcc-CCccHHHHHHHHHHHHHHHHHHH
Confidence            456777777766542111 01226789999999999998643


No 67 
>TIGR02412 pepN_strep_liv aminopeptidase N, Streptomyces lividans type. This family is a subset of the members of the zinc metallopeptidase family M1 (pfam01433), with a single member characterized in Streptomyces lividans 66 and designated aminopeptidase N. The spectrum of activity may differ somewhat from the aminopeptidase N clade of E. coli and most other Proteobacteria, well separated phylogenetically within the M1 family. The M1 family also includes leukotriene A-4 hydrolase/aminopeptidase (with a bifunctional active site).
Probab=55.54  E-value=6.6  Score=43.06  Aligned_cols=19  Identities=21%  Similarity=0.242  Sum_probs=16.0

Q ss_pred             hHHHHHHHHHHhhhcCCCC
Q 038987           46 FHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~   64 (316)
                      ...+..||+|||||.++||
T Consensus       284 ~~~~~~viaHElAHqWFGn  302 (831)
T TIGR02412       284 KENRAGVILHEMAHMWFGD  302 (831)
T ss_pred             HHHHHHHHHHHHHHHHhCC
Confidence            3467899999999999983


No 68 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=55.53  E-value=9  Score=25.28  Aligned_cols=21  Identities=10%  Similarity=0.052  Sum_probs=11.7

Q ss_pred             eeeccCCcccCc--CccccccCC
Q 038987          295 WTCKFWTLENCV--KLDKCSRVS  315 (316)
Q Consensus       295 WsC~~CT~~N~~--~~~~C~~C~  315 (316)
                      |.|..|.|.-..  .-++|-.|+
T Consensus         2 ~~C~~CGy~y~~~~~~~~CP~Cg   24 (33)
T cd00350           2 YVCPVCGYIYDGEEAPWVCPVCG   24 (33)
T ss_pred             EECCCCCCEECCCcCCCcCcCCC
Confidence            666666655222  355666665


No 69 
>PF13699 DUF4157:  Domain of unknown function (DUF4157)
Probab=55.27  E-value=4.5  Score=31.87  Aligned_cols=33  Identities=27%  Similarity=0.158  Sum_probs=19.6

Q ss_pred             CccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCC
Q 038987           26 AGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIA   63 (316)
Q Consensus        26 ~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~   63 (316)
                      .|..|.|+--...     .....=..+|.|||+|.+.-
T Consensus        43 ~G~~I~f~~g~~~-----~~s~~~~~llaHEl~Hv~Qq   75 (79)
T PF13699_consen   43 VGNDIYFAPGKYN-----PDSPEGRALLAHELAHVVQQ   75 (79)
T ss_pred             ECCEEEEcCCCcC-----CCCCCcchhHhHHHHHHHhh
Confidence            4778888432110     11122457899999998753


No 70 
>PF12725 DUF3810:  Protein of unknown function (DUF3810);  InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised. Proteins in this family are typically between 333 and 377 amino acids in length and contain a conserved HEXXH sequence motif that is characteristic of metallopeptidases. This family may therefore belong to an as yet uncharacterised family of peptidase enzymes.
Probab=54.89  E-value=3.6  Score=40.28  Aligned_cols=45  Identities=24%  Similarity=0.244  Sum_probs=31.5

Q ss_pred             CChHHHHHHHHHHhhhcCC--CCCChhHHHHHHHHHHHHHHHHhccc
Q 038987           44 LPFHEVLDTMLHELCHNDI--APHDAKFYKLWEELREECDELRSKGI   88 (316)
Q Consensus        44 lP~~~I~~vllHELaH~~~--~~H~~~Fy~ll~~l~~e~~~l~~~G~   88 (316)
                      .|.-.+=.|++|||||..-  ..=.++|+.+|.-...+=..++..||
T Consensus       191 ~p~~~~P~T~~HElAHq~G~a~E~EANFiayLac~~s~d~~frYSgy  237 (318)
T PF12725_consen  191 LPPYSLPFTICHELAHQLGFASEDEANFIAYLACINSPDPYFRYSGY  237 (318)
T ss_pred             CCcccccHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCChheeHHHH
Confidence            4455566799999999873  35567899998877655555555544


No 71 
>PF06262 DUF1025:  Possibl zinc metallo-peptidase;  InterPro: IPR010428 This is a family of bacterial protein with undetermined function.; PDB: 3E11_A.
Probab=54.21  E-value=7.7  Score=31.98  Aligned_cols=16  Identities=31%  Similarity=0.447  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHhhhcCC
Q 038987           47 HEVLDTMLHELCHNDI   62 (316)
Q Consensus        47 ~~I~~vllHELaH~~~   62 (316)
                      +.|..|++||++|..-
T Consensus        71 ~~I~~tlvhEiah~fG   86 (97)
T PF06262_consen   71 ELIRDTLVHEIAHHFG   86 (97)
T ss_dssp             HHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHcC
Confidence            5688999999999753


No 72 
>PF06167 Peptidase_M90:  Glucose-regulated metallo-peptidase M90;  InterPro: IPR010384  MtfA (earlier known as YeeI) is a transcription factor that binds Mlc (make large colonies), itself a repressor of glucose and hence a protein important in regulation of the phosphoenolpyruvate:glucose-phosphotransferase (PtsG) system, the major glucose transporter in Escherichia coli. Mlc is a repressor of ptsG, and MtfA is found to bind and inactivate Mlc with high affinity []. The membrane-bound protein EIICBGlc encoded by the ptsG gene is the major glucose transporter in E. coli. ; PDB: 3DL1_A 3KHI_A.
Probab=53.41  E-value=13  Score=35.38  Aligned_cols=65  Identities=20%  Similarity=0.336  Sum_probs=32.9

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCC----------CChhHHHHHHHHH-HHHHHHHhc
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAP----------HDAKFYKLWEELR-EECDELRSK   86 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~----------H~~~Fy~ll~~l~-~e~~~l~~~   86 (316)
                      ++|-....| .|-|.+-...  ..+.....=..|++||+||...+.          |....++-|.+++ ++|+.+...
T Consensus       127 ~~Geaw~~G-~vvLSW~~~~--~g~~~~~dg~NVviHEfAH~LD~~~g~adG~P~l~~~~~~~~W~~~~~~~~~~l~~~  202 (253)
T PF06167_consen  127 LLGEAWERG-PVVLSWEDVQ--EGFENPNDGHNVVIHEFAHKLDMEDGAADGVPPLHPGMSYRRWHKVFSAEYERLRER  202 (253)
T ss_dssp             --------S--EEEEHHHHH--HCT--SSSS--HHHHHHHHHHHCTTS--SS--S---GGGHHHHHHHHHHHHHHHHHH
T ss_pred             hhhccccCC-cEEEEHHHHh--hccCCCCCCcchHHHHHHHHHHhhcCCCCCCCccCCcccHHHHHHHHHHHHHHHHHH
Confidence            456555555 6777766432  123444455689999999998552          5566676666554 678877753


No 73 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=53.03  E-value=12  Score=28.22  Aligned_cols=37  Identities=22%  Similarity=0.625  Sum_probs=25.4

Q ss_pred             CccccCcceeccCC------CCCCCCCCCCCCCCCceeeccCCc
Q 038987          265 AMWECKACTFLNHG------CGSVPHQGDASANDRVWTCKFWTL  302 (316)
Q Consensus       265 ~~W~C~~CTllN~~------C~~C~rPr~~~~~~~~WsC~~CT~  302 (316)
                      ..|.|..|-++=.+      |++|..-+- .--+..|.|+-|.+
T Consensus         2 ~~~~C~~CG~vYd~e~Gdp~~gi~pgT~f-edlPd~w~CP~Cg~   44 (55)
T COG1773           2 KRWRCSVCGYVYDPEKGDPRCGIAPGTPF-EDLPDDWVCPECGV   44 (55)
T ss_pred             CceEecCCceEeccccCCccCCCCCCCch-hhCCCccCCCCCCC
Confidence            37999999998777      877543221 11234699999986


No 74 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=52.74  E-value=5.5  Score=33.34  Aligned_cols=24  Identities=17%  Similarity=0.138  Sum_probs=20.4

Q ss_pred             CChHHHHHHHHHHhhhcCCCCCCh
Q 038987           44 LPFHEVLDTMLHELCHNDIAPHDA   67 (316)
Q Consensus        44 lP~~~I~~vllHELaH~~~~~H~~   67 (316)
                      .+...+..|++|||-|..--.|+.
T Consensus       100 ~~~~~~~~v~~HEiGHaLGL~H~~  123 (154)
T PF00413_consen  100 DSGNDLQSVAIHEIGHALGLDHSN  123 (154)
T ss_dssp             SSSEEHHHHHHHHHHHHTTBESSS
T ss_pred             hhhhhhhhhhhhccccccCcCcCC
Confidence            455678999999999999888873


No 75 
>PF13203 DUF2201_N:  Putative metallopeptidase domain
Probab=51.86  E-value=11  Score=35.72  Aligned_cols=47  Identities=26%  Similarity=0.318  Sum_probs=33.0

Q ss_pred             ccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCC----------CChhHHHHHHHHH
Q 038987           27 GVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAP----------HDAKFYKLWEELR   77 (316)
Q Consensus        27 G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~----------H~~~Fy~ll~~l~   77 (316)
                      |..|.++-..-    .-++.+.+..+++||+-|++..+          .+...|.+=-.+.
T Consensus        42 g~~l~~nP~~~----~~l~~~~~~~~l~HevlH~~~~H~~r~~~~~~~~d~~~wn~A~Di~   98 (292)
T PF13203_consen   42 GRRLYYNPEFL----ESLSPEERVGLLLHEVLHCLLRHPWRRGGLRKRRDPELWNLACDIA   98 (292)
T ss_pred             CcEEEECcHHH----hcCCHHHHHHHHHHHHHHHHccchhhhccccccccHHHHHHHhHHH
Confidence            45787777664    24677889999999999998764          4556665544443


No 76 
>KOG4345 consensus NF-kappa B regulator AP20/Cezanne [Signal transduction mechanisms]
Probab=51.77  E-value=4.1  Score=44.10  Aligned_cols=24  Identities=13%  Similarity=0.044  Sum_probs=13.8

Q ss_pred             CCCCCccccCcceeccCC----CCCCCC
Q 038987          261 PEEPAMWECKACTFLNHG----CGSVPH  284 (316)
Q Consensus       261 ~~~~~~W~C~~CTllN~~----C~~C~r  284 (316)
                      ....-+|.|++||++|++    |..|..
T Consensus        86 ~~~~~k~~~~~~~~lnw~re~R~~~~ls  113 (774)
T KOG4345|consen   86 IDRNIKWPRPSLQRLNWPREKRLSRGLS  113 (774)
T ss_pred             ccccccCCchHhhhhhHHHHHHHHHHhh
Confidence            344446666666666666    665544


No 77 
>TIGR02411 leuko_A4_hydro leukotriene A-4 hydrolase/aminopeptidase. Members of this family represent a distinctive subset within the zinc metallopeptidase family M1 (pfam01433). The majority of the members of pfam01433 are aminopeptidases, but the sequences in this family for which the function is known are leukotriene A-4 hydrolase. A dual epoxide hydrolase and aminopeptidase activity at the same active site is indicated. The physiological substrate for aminopeptidase activity is not known.
Probab=50.96  E-value=8.8  Score=40.66  Aligned_cols=16  Identities=31%  Similarity=0.401  Sum_probs=14.1

Q ss_pred             HHHHHHHHhhhcCCCC
Q 038987           49 VLDTMLHELCHNDIAP   64 (316)
Q Consensus        49 I~~vllHELaH~~~~~   64 (316)
                      ...||+|||||-+.||
T Consensus       279 ~~~viaHElAHqWfGN  294 (601)
T TIGR02411       279 NVDVIAHELAHSWSGN  294 (601)
T ss_pred             hhhhHHHHHHhhccCc
Confidence            4579999999999994


No 78 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=50.66  E-value=14  Score=42.64  Aligned_cols=47  Identities=17%  Similarity=0.299  Sum_probs=35.9

Q ss_pred             CccccCcceeccCC--CCCCCCCCCCCCCCCceeeccCCcccCcC---ccccccCCC
Q 038987          265 AMWECKACTFLNHG--CGSVPHQGDASANDRVWTCKFWTLENCVK---LDKCSRVSK  316 (316)
Q Consensus       265 ~~W~C~~CTllN~~--C~~C~rPr~~~~~~~~WsC~~CT~~N~~~---~~~C~~C~~  316 (316)
                      ..-.|+.|--....  |..|..+.     ...+.|+.|..+....   ...|.-|++
T Consensus       666 ~~rkCPkCG~~t~~~fCP~CGs~t-----e~vy~CPsCGaev~~des~a~~CP~CGt  717 (1337)
T PRK14714        666 GRRRCPSCGTETYENRCPDCGTHT-----EPVYVCPDCGAEVPPDESGRVECPRCDV  717 (1337)
T ss_pred             EEEECCCCCCccccccCcccCCcC-----CCceeCccCCCccCCCccccccCCCCCC
Confidence            35789999987766  99998763     2358999999876543   568999985


No 79 
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=50.30  E-value=18  Score=31.02  Aligned_cols=23  Identities=17%  Similarity=0.153  Sum_probs=19.9

Q ss_pred             ChHHHHHHHHHHhhhcCCCCCCh
Q 038987           45 PFHEVLDTMLHELCHNDIAPHDA   67 (316)
Q Consensus        45 P~~~I~~vllHELaH~~~~~H~~   67 (316)
                      +...+..|++|||=|..--.|..
T Consensus       103 ~~~~~~~~~~HEiGHaLGL~H~~  125 (157)
T cd04278         103 GGTDLFSVAAHEIGHALGLGHSS  125 (157)
T ss_pred             ccchHHHHHHHHhccccccCCCC
Confidence            45679999999999999989984


No 80 
>KOG1046 consensus Puromycin-sensitive aminopeptidase and related aminopeptidases [Amino acid transport and metabolism; Posttranslational modification, protein turnover, chaperones]
Probab=49.42  E-value=9.4  Score=42.32  Aligned_cols=19  Identities=26%  Similarity=0.365  Sum_probs=17.7

Q ss_pred             hHHHHHHHHHHhhhcCCCC
Q 038987           46 FHEVLDTMLHELCHNDIAP   64 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~   64 (316)
                      +..|..||+|||||-++||
T Consensus       321 k~~va~vIaHElAHQWFGN  339 (882)
T KOG1046|consen  321 KQRVAEVIAHELAHQWFGN  339 (882)
T ss_pred             HHHHHHHHHHHHHHHHhcC
Confidence            6779999999999999997


No 81 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=49.17  E-value=6.2  Score=27.18  Aligned_cols=17  Identities=24%  Similarity=0.702  Sum_probs=10.5

Q ss_pred             CCCceeeccCCcccCcC
Q 038987          291 NDRVWTCKFWTLENCVK  307 (316)
Q Consensus       291 ~~~~WsC~~CT~~N~~~  307 (316)
                      ..+.|.|.+|...|...
T Consensus        21 ~~~~w~C~~C~~~N~lp   37 (40)
T PF04810_consen   21 GGKTWICNFCGTKNPLP   37 (40)
T ss_dssp             TTTEEEETTT--EEE--
T ss_pred             CCCEEECcCCCCcCCCC
Confidence            34579999999988764


No 82 
>PF10023 DUF2265:  Predicted aminopeptidase (DUF2265);  InterPro: IPR014553 This group represents a predicted aminopeptidase.
Probab=47.84  E-value=30  Score=34.66  Aligned_cols=43  Identities=23%  Similarity=0.313  Sum_probs=32.5

Q ss_pred             CCChHHHHHHHHHHhhhcC-CCCCChhHHHHHHHHHHHHHHHHh
Q 038987           43 SLPFHEVLDTMLHELCHND-IAPHDAKFYKLWEELREECDELRS   85 (316)
Q Consensus        43 flP~~~I~~vllHELaH~~-~~~H~~~Fy~ll~~l~~e~~~l~~   85 (316)
                      -+|-..+-.+|+|||||-+ +-+-|..|-.-+..+..+.-..++
T Consensus       159 ~~~~~~LA~LIfHELaHq~~Yv~~dt~FNEsfAtfVe~~G~~~w  202 (337)
T PF10023_consen  159 RYPDGELARLIFHELAHQTLYVKGDTAFNESFATFVEREGARRW  202 (337)
T ss_pred             CCCchHHHHHHHHHHhhceeecCCCchhhHHHHHHHHHHHHHHH
Confidence            3566789999999999987 557778888888777766654444


No 83 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=47.59  E-value=9.4  Score=32.29  Aligned_cols=22  Identities=36%  Similarity=0.277  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHhhhcCCCCCChh
Q 038987           47 HEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        47 ~~I~~vllHELaH~~~~~H~~~   68 (316)
                      .....|++|||.|.+-..|+..
T Consensus        94 ~~~~~~~~HElGH~LGl~H~~~  115 (167)
T cd00203          94 KEGAQTIAHELGHALGFYHDHD  115 (167)
T ss_pred             ccchhhHHHHHHHHhCCCccCc
Confidence            4678999999999999999865


No 84 
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=42.40  E-value=28  Score=30.59  Aligned_cols=39  Identities=21%  Similarity=0.097  Sum_probs=26.5

Q ss_pred             ccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCCCCCh
Q 038987           27 GVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIAPHDA   67 (316)
Q Consensus        27 G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~~H~~   67 (316)
                      +..|.|+.......  ..+-....+|++|||-|.+--.|..
T Consensus        93 ~g~i~~~~~~~~~~--~~~g~~~~~t~~HEiGHaLGL~H~~  131 (186)
T cd04277          93 GGDIWFNSSYDTNS--DSPGSYGYQTIIHEIGHALGLEHPG  131 (186)
T ss_pred             cceeEEecCccccc--CCCChhhHHHHHHHHHHHhcCCCCC
Confidence            34677776654211  1355678899999999998776653


No 85 
>PF13058 DUF3920:  Protein of unknown function (DUF3920)
Probab=41.65  E-value=11  Score=32.43  Aligned_cols=20  Identities=35%  Similarity=0.467  Sum_probs=17.4

Q ss_pred             CCChHHHHHHHHHHhhhcCC
Q 038987           43 SLPFHEVLDTMLHELCHNDI   62 (316)
Q Consensus        43 flP~~~I~~vllHELaH~~~   62 (316)
                      |-.|+.|+.||+||+-|-..
T Consensus        70 we~y~qvlktllhefrh~mQ   89 (126)
T PF13058_consen   70 WEEYEQVLKTLLHEFRHAMQ   89 (126)
T ss_pred             hHHHHHHHHHHHHHHHHHHH
Confidence            56789999999999999765


No 86 
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=41.34  E-value=19  Score=30.49  Aligned_cols=22  Identities=27%  Similarity=0.193  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHhhhcCCCCCChh
Q 038987           47 HEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        47 ~~I~~vllHELaH~~~~~H~~~   68 (316)
                      ..+..|++|||-|.+-..|...
T Consensus        92 ~~~~~~~~HEiGHaLGL~H~~~  113 (165)
T cd04268          92 ARLRNTAEHELGHALGLRHNFA  113 (165)
T ss_pred             HHHHHHHHHHHHHHhcccccCc
Confidence            5689999999999998888765


No 87 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=39.80  E-value=19  Score=24.05  Aligned_cols=23  Identities=22%  Similarity=0.456  Sum_probs=15.8

Q ss_pred             ceeeccCCcccCc--CccccccCCC
Q 038987          294 VWTCKFWTLENCV--KLDKCSRVSK  316 (316)
Q Consensus       294 ~WsC~~CT~~N~~--~~~~C~~C~~  316 (316)
                      .|.|..|.|.=..  .-.+|.+|+.
T Consensus         2 ~~~C~~CG~i~~g~~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGEEAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECCcCCCcCcCCCC
Confidence            5888888876333  3468888873


No 88 
>PF10463 Peptidase_U49:  Peptidase U49;  InterPro: IPR019504 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported.  This entry contains peptidases belonging to MEROPS peptidase family U49 (Lit peptidase, clan U-). The Lit peptidase from Escherichia coli functions in bacterial cell death in response to infection by Enterobacteria phage T4. Following binding of Gol peptide to domains II and III of elongation factor Tu, the Lit peptidase cleaves domain I of the elongation factor. This prevents binding of guanine nucleotides, shuts down translation and leads to cell death. 
Probab=39.15  E-value=14  Score=34.40  Aligned_cols=19  Identities=26%  Similarity=0.370  Sum_probs=14.5

Q ss_pred             HHHHHHHHhhhcCCCCCCh
Q 038987           49 VLDTMLHELCHNDIAPHDA   67 (316)
Q Consensus        49 I~~vllHELaH~~~~~H~~   67 (316)
                      +-.+|+||++|++++.=..
T Consensus       101 ~~fil~HE~~Hv~~~h~~~  119 (206)
T PF10463_consen  101 IAFILLHELAHVVLGHEGD  119 (206)
T ss_pred             HHHHHHHHHHHHHHcCccc
Confidence            4578999999987765444


No 89 
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription]
Probab=38.83  E-value=13  Score=36.57  Aligned_cols=37  Identities=16%  Similarity=0.614  Sum_probs=23.7

Q ss_pred             CccccCcceeccC-------C----CCCC--------CCCCCCCCCCCceeeccCC
Q 038987          265 AMWECKACTFLNH-------G----CGSV--------PHQGDASANDRVWTCKFWT  301 (316)
Q Consensus       265 ~~W~C~~CTllN~-------~----C~~C--------~rPr~~~~~~~~WsC~~CT  301 (316)
                      -.|+|--|-+-|-       -    |.-|        ..|..+.++...|+|+.|-
T Consensus       274 yrwqcieck~csicgtsenddqllfcddcdrgyhmyclsppm~eppegswsc~KOG  329 (336)
T KOG1244|consen  274 YRWQCIECKYCSICGTSENDDQLLFCDDCDRGYHMYCLSPPMVEPPEGSWSCHLCL  329 (336)
T ss_pred             heeeeeecceeccccCcCCCceeEeecccCCceeeEecCCCcCCCCCCchhHHHHH
Confidence            4799988877332       1    4444        3344455566789999985


No 90 
>COG5100 NPL4 Nuclear pore protein [Nuclear structure]
Probab=38.47  E-value=7  Score=40.26  Aligned_cols=20  Identities=45%  Similarity=1.049  Sum_probs=16.5

Q ss_pred             CccccCcceeccCC----CCCCCC
Q 038987          265 AMWECKACTFLNHG----CGSVPH  284 (316)
Q Consensus       265 ~~W~C~~CTllN~~----C~~C~r  284 (316)
                      -.|+|++|||+|..    |..|..
T Consensus       545 y~we~~~~~~i~~~~~~t~~m~~~  568 (571)
T COG5100         545 YRWECKMCTFINEKNSCTCEMCNS  568 (571)
T ss_pred             HHHHHHHHHHhcccCceEEEeecc
Confidence            46999999999998    677654


No 91 
>COG4324 Predicted aminopeptidase [General function prediction only]
Probab=37.98  E-value=49  Score=32.74  Aligned_cols=47  Identities=19%  Similarity=0.203  Sum_probs=33.8

Q ss_pred             ChHHHHHHHHHHhhhcC-CCCCChhHHHHHHHHHHHHHHHHhccccCC
Q 038987           45 PFHEVLDTMLHELCHND-IAPHDAKFYKLWEELREECDELRSKGITGV   91 (316)
Q Consensus        45 P~~~I~~vllHELaH~~-~~~H~~~Fy~ll~~l~~e~~~l~~~G~~G~   91 (316)
                      |-+.|-..|.|||+|-+ +-+.|..|-.-.......--..+|.-++|.
T Consensus       193 dd~~lA~LIFHELAHQk~Y~~~DtAFNEsFAtaVEt~Gvr~Wl~~~g~  240 (376)
T COG4324         193 DDTYLASLIFHELAHQKIYVNNDTAFNESFATAVETSGVRKWLRATGD  240 (376)
T ss_pred             ChHHHHHHHHHHHhhheEeecCcchHhHHHHHHHHHHhHHHHHHhcCC
Confidence            45678888999999987 568888888777766655555555555555


No 92 
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=37.79  E-value=17  Score=33.11  Aligned_cols=18  Identities=39%  Similarity=0.414  Sum_probs=17.1

Q ss_pred             HHHHHHhhhcCCCCCChh
Q 038987           51 DTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        51 ~vllHELaH~~~~~H~~~   68 (316)
                      +|++|||-|+.-..|+..
T Consensus       139 ~~~aHEiGH~lGl~H~~~  156 (206)
T PF13583_consen  139 QTFAHEIGHNLGLRHDFD  156 (206)
T ss_pred             hHHHHHHHHHhcCCCCcc
Confidence            789999999999999988


No 93 
>PF14891 Peptidase_M91:  Effector protein
Probab=35.68  E-value=12  Score=33.17  Aligned_cols=19  Identities=21%  Similarity=0.167  Sum_probs=14.7

Q ss_pred             HHHHHHHhhhcCCCCCChh
Q 038987           50 LDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        50 ~~vllHELaH~~~~~H~~~   68 (316)
                      .-+|.|||+|-.|.-++..
T Consensus       104 ~v~L~HEL~HA~~~~~Gt~  122 (174)
T PF14891_consen  104 FVVLYHELIHAYDYMNGTM  122 (174)
T ss_pred             HHHHHHHHHHHHHHHCCCC
Confidence            4688999999887666554


No 94 
>PF01457 Peptidase_M8:  Leishmanolysin This Prosite motif covers only the active site. This is family M8 in the peptidase classification. ;  InterPro: IPR001577 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M8 (leishmanolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA.   Leishmanolysin is an enzyme found in the eukaryotes including Leishmania and related parasitic protozoa []. The endopeptidase is the most abundant protein on the cell surface during the promastigote stage of the parasite, and is attached to the membrane by a glycosylphosphatidylinositol anchor []. In the amastigote form, the parasite lives in lysosomes of host macrophages, producing a form of the protease that has an acidic pH optimum []. This differs from most other metalloproteases and may be an adaptation to the environment in which the organism survives [].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0007155 cell adhesion, 0016020 membrane; PDB: 1LML_A.
Probab=34.94  E-value=27  Score=36.39  Aligned_cols=30  Identities=23%  Similarity=0.273  Sum_probs=17.6

Q ss_pred             EEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCC
Q 038987           29 HIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDI   62 (316)
Q Consensus        29 ~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~   62 (316)
                      .|.|.......   + .+....+|++||++|..-
T Consensus       194 ~in~~p~~i~~---~-~~~~~~~~~~HEi~HaLG  223 (521)
T PF01457_consen  194 VININPSYIPS---F-YFQEFFRTVIHEIAHALG  223 (521)
T ss_dssp             EEE--GGG------S---HHHHHHHHHHHHHHTT
T ss_pred             EEEEchhHccc---h-hhhcccceeeeeeeeeee
Confidence            45555544321   1 467888999999999984


No 95 
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=34.91  E-value=27  Score=29.81  Aligned_cols=23  Identities=26%  Similarity=0.179  Sum_probs=19.6

Q ss_pred             hHHHHHHHHHHhhhcCCCCCChh
Q 038987           46 FHEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~H~~~   68 (316)
                      ...+..|++|||=|.+--.|...
T Consensus       101 ~~~~~~~~~HEiGHaLGL~H~~~  123 (156)
T cd04279         101 AENLQAIALHELGHALGLWHHSD  123 (156)
T ss_pred             chHHHHHHHHHhhhhhcCCCCCC
Confidence            35789999999999998888765


No 96 
>KOG3607 consensus Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family [Posttranslational modification, protein turnover, chaperones]
Probab=34.88  E-value=22  Score=38.90  Aligned_cols=22  Identities=32%  Similarity=0.274  Sum_probs=19.8

Q ss_pred             hHHHHHHHHHHhhhcCCCCCCh
Q 038987           46 FHEVLDTMLHELCHNDIAPHDA   67 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~H~~   67 (316)
                      +.....||+|||+|++-+.||.
T Consensus       320 ~~~~a~v~AhelgH~lGm~hD~  341 (716)
T KOG3607|consen  320 LLAFAVVLAHELGHNLGMIHDE  341 (716)
T ss_pred             chhHHHHHHHHHHhhcCccccc
Confidence            4567789999999999999999


No 97 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=33.83  E-value=18  Score=30.17  Aligned_cols=38  Identities=26%  Similarity=0.502  Sum_probs=25.1

Q ss_pred             ccCcce----ec-cCC--CCCCCCCCCCCCCCCceeeccCCccc-CcCccccccCC
Q 038987          268 ECKACT----FL-NHG--CGSVPHQGDASANDRVWTCKFWTLEN-CVKLDKCSRVS  315 (316)
Q Consensus       268 ~C~~CT----ll-N~~--C~~C~rPr~~~~~~~~WsC~~CT~~N-~~~~~~C~~C~  315 (316)
                      .|..|.    |+ |.+  |..|.          ..+|+.|...+ ....|+|-+|-
T Consensus        56 ~C~~C~~~fg~l~~~~~~C~~C~----------~~VC~~C~~~~~~~~~WlC~vC~  101 (118)
T PF02318_consen   56 HCARCGKPFGFLFNRGRVCVDCK----------HRVCKKCGVYSKKEPIWLCKVCQ  101 (118)
T ss_dssp             B-TTTS-BCSCTSTTCEEETTTT----------EEEETTSEEETSSSCCEEEHHHH
T ss_pred             chhhhCCcccccCCCCCcCCcCC----------ccccCccCCcCCCCCCEEChhhH
Confidence            566662    33 455  77776          37888888764 56788888873


No 98 
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=33.36  E-value=30  Score=32.35  Aligned_cols=22  Identities=23%  Similarity=0.164  Sum_probs=18.7

Q ss_pred             ChHHHHHHHHHHhhhcCCCCCC
Q 038987           45 PFHEVLDTMLHELCHNDIAPHD   66 (316)
Q Consensus        45 P~~~I~~vllHELaH~~~~~H~   66 (316)
                      +.+.-..||+|||-|.+-+.+.
T Consensus        68 ~~~r~rFtlAHELGH~llH~~~   89 (213)
T COG2856          68 SLERKRFTLAHELGHALLHTDL   89 (213)
T ss_pred             CHHHHHHHHHHHHhHHHhcccc
Confidence            5677889999999999977665


No 99 
>PHA02456 zinc metallopeptidase motif-containing protein
Probab=32.79  E-value=20  Score=30.98  Aligned_cols=16  Identities=38%  Similarity=0.352  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHhhhcCC
Q 038987           47 HEVLDTMLHELCHNDI   62 (316)
Q Consensus        47 ~~I~~vllHELaH~~~   62 (316)
                      .-.+.|+.|||+|++.
T Consensus        77 KGC~~TL~HEL~H~WQ   92 (141)
T PHA02456         77 KGCRDTLAHELNHAWQ   92 (141)
T ss_pred             cchHHHHHHHHHHHHh
Confidence            3468999999999863


No 100
>KOG2719 consensus Metalloprotease [General function prediction only]
Probab=32.28  E-value=24  Score=36.38  Aligned_cols=42  Identities=24%  Similarity=0.173  Sum_probs=30.0

Q ss_pred             ccccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCC
Q 038987           19 ALGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIA   63 (316)
Q Consensus        19 lLGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~   63 (316)
                      +.|+..|+.-+|.=.|-..   .....-++|..|++|||.|-.++
T Consensus       253 fyG~~~~KRIvIyDtLl~~---~~~~~~eel~AVl~HELGHW~~~  294 (428)
T KOG2719|consen  253 FYGLCKNKRIVIYDTLLLE---EEHLNNEELVAVLAHELGHWKLN  294 (428)
T ss_pred             eeeccccceEEEehhhhhh---hhccccHHHHHHHHHHhhHHHHh
Confidence            7899888886665444421   11145689999999999997764


No 101
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=31.83  E-value=21  Score=29.67  Aligned_cols=18  Identities=28%  Similarity=0.211  Sum_probs=15.2

Q ss_pred             HHHHHHhhhcCCCCCChh
Q 038987           51 DTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        51 ~vllHELaH~~~~~H~~~   68 (316)
                      .|++|||-|.+-..|...
T Consensus        88 ~~~~HEigHaLGl~H~~~  105 (140)
T smart00235       88 GVAAHELGHALGLYHEQS  105 (140)
T ss_pred             ccHHHHHHHHhcCCcCCC
Confidence            599999999998777764


No 102
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=30.68  E-value=33  Score=32.50  Aligned_cols=23  Identities=9%  Similarity=0.212  Sum_probs=11.2

Q ss_pred             CceeeccCCcccCcCccccccCC
Q 038987          293 RVWTCKFWTLENCVKLDKCSRVS  315 (316)
Q Consensus       293 ~~WsC~~CT~~N~~~~~~C~~C~  315 (316)
                      +.|.|..|.+.-..-.+.|.-|+
T Consensus       353 p~~~c~~cg~~~~~~~~~c~~c~  375 (389)
T PRK11788        353 PRYRCRNCGFTARTLYWHCPSCK  375 (389)
T ss_pred             CCEECCCCCCCCccceeECcCCC
Confidence            34555555544444444555444


No 103
>PF08434 CLCA_N:  Calcium-activated chloride channel;  InterPro: IPR013642 The CLCA family of calcium-activated chloride channels has been identified in many epithelial and endothelial cell types as well as in smooth muscle cells [] and has four or five putative transmembrane regions. Additionally to their role as chloride channels some CLCA proteins function as adhesion molecules and may also have roles as tumour suppressors []. The domain described here is found at the N terminus of CLCAs. 
Probab=30.32  E-value=12  Score=36.06  Aligned_cols=43  Identities=21%  Similarity=0.117  Sum_probs=26.2

Q ss_pred             cccccCCccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCC
Q 038987           20 LGSNLGAGVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIA   63 (316)
Q Consensus        20 LGlN~N~G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~   63 (316)
                      .|-+-..|..|.|--...-++.. .-|.-.-.+++||-||+.+|
T Consensus       121 ~g~CGe~G~yIhltp~fl~~~~~-~~yG~~grv~VhEWAhlRWG  163 (262)
T PF08434_consen  121 YGGCGEPGEYIHLTPDFLLGDNL-SQYGPRGRVFVHEWAHLRWG  163 (262)
T ss_pred             CCCCCCCCeeEEechhhhcCCch-hhcCCcceeeeehhhhhccc
Confidence            35677788888884332211110 11222468899999999987


No 104
>PF07209 DUF1415:  Protein of unknown function (DUF1415);  InterPro: IPR009858 This family consists of several hypothetical bacterial proteins of around 180 residues in length. The function of this family is unknown.
Probab=30.25  E-value=1.7e+02  Score=26.77  Aligned_cols=56  Identities=20%  Similarity=0.293  Sum_probs=38.7

Q ss_pred             EEEEeeecCCCCCCCCChHHHHHHHHHHhhhc-------------CCCCCChhHHHHHHHHHHHHHHHH-hccccCC
Q 038987           29 HIKLLLRKLNRDRESLPFHEVLDTMLHELCHN-------------DIAPHDAKFYKLWEELREECDELR-SKGITGV   91 (316)
Q Consensus        29 ~I~LRLR~~~~~~~flP~~~I~~vllHELaH~-------------~~~~H~~~Fy~ll~~l~~e~~~l~-~~G~~G~   91 (316)
                      .|++..-...      ..+.+...+++||.++             ++++--..|+.+++ +.+..+.+. ..|+.|.
T Consensus        33 ~Ir~~V~~a~------~~~~ll~~l~~El~~L~~~~~~~ieTTLli~P~~l~dF~dy~d-fl~~a~~ll~~~~~eG~  102 (174)
T PF07209_consen   33 QIRYVVSEAT------DPEDLLEDLLEELQRLAADDEPEIETTLLIFPNGLDDFDDYND-FLDMADALLEELGLEGV  102 (174)
T ss_pred             CEEEEEeCCC------CHHHHHHHHHHHHHHHhcCCccccceEEEECCCcccCHHHHHH-HHHHHHHHHHHcCCCce
Confidence            5666665543      3478899999999998             55666778999998 445555543 4666654


No 105
>PRK09672 phage exclusion protein Lit; Provisional
Probab=30.11  E-value=27  Score=34.50  Aligned_cols=18  Identities=22%  Similarity=0.390  Sum_probs=14.4

Q ss_pred             HHHHHHHHhhhcCCCCCC
Q 038987           49 VLDTMLHELCHNDIAPHD   66 (316)
Q Consensus        49 I~~vllHELaH~~~~~H~   66 (316)
                      +-++++||++|++++.=.
T Consensus       165 ~a~i~~HEiaHv~~~h~~  182 (305)
T PRK09672        165 LAWILLHEIAHVEFQHSS  182 (305)
T ss_pred             HHHHHHHHHHHHHhcccc
Confidence            558999999999986443


No 106
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=29.91  E-value=38  Score=30.68  Aligned_cols=23  Identities=26%  Similarity=0.147  Sum_probs=18.5

Q ss_pred             hHHHHHHHHHHhhhcCCCCCChh
Q 038987           46 FHEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~H~~~   68 (316)
                      .+.+..+++|||-|+.-..|-..
T Consensus       122 ~~R~~k~~~HElGH~lGL~HC~~  144 (179)
T PRK13267        122 EERVRKEVTHELGHTLGLEHCDN  144 (179)
T ss_pred             HHHHHHHHHHHHHHHcCCccCCC
Confidence            45667779999999999999443


No 107
>KOG1047 consensus Bifunctional leukotriene A4 hydrolase/aminopeptidase LTA4H [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Defense mechanisms; Amino acid transport and metabolism]
Probab=28.96  E-value=26  Score=37.50  Aligned_cols=19  Identities=21%  Similarity=0.389  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHhhhcCCCCC
Q 038987           47 HEVLDTMLHELCHNDIAPH   65 (316)
Q Consensus        47 ~~I~~vllHELaH~~~~~H   65 (316)
                      ..+..||+||+||-+.||=
T Consensus       286 rsl~~vIaHEIAHSWtGNl  304 (613)
T KOG1047|consen  286 RSLVDVIAHEIAHSWTGNL  304 (613)
T ss_pred             cchhhHHHHHhhhhhcccc
Confidence            3457899999999998863


No 108
>COG3227 LasB Zinc metalloprotease (elastase) [Amino acid transport and metabolism]
Probab=28.61  E-value=15  Score=38.35  Aligned_cols=58  Identities=24%  Similarity=0.318  Sum_probs=36.1

Q ss_pred             ccccCC----ccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCC------------CCChhHHHHHHHHHHHHH
Q 038987           21 GSNLGA----GVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIA------------PHDAKFYKLWEELREECD   81 (316)
Q Consensus        21 GlN~N~----G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~------------~H~~~Fy~ll~~l~~e~~   81 (316)
                      |.|+|.    |..+.+   -+.|...|-|+.--+.|+.|||+|=+-.            -=+..|=+..-.+..-|.
T Consensus       308 G~~ynNAfWdG~qMvy---GDGDG~~f~~~S~sLDVvAHElTHGvtq~tA~L~Y~~qsGALNEsfSDvfG~~i~~~~  381 (507)
T COG3227         308 GKNYNNAFWDGDQMVY---GDGDGSFFTPFSGSLDVVAHELTHGVTQQTAGLIYRGQSGALNESFSDVFGTLIEQYV  381 (507)
T ss_pred             ccccccccccCceeEe---ecCCcceecccccccceehhhhcchhhhhccCceecCCCCchhhHHHHHHHHHHHHHh
Confidence            666652    544332   2455556888888899999999996543            234456555555554443


No 109
>PF05548 Peptidase_M11:  Gametolysin peptidase M11;  InterPro: IPR008752 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M11 (gametolysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The type example is gametolysin from the unicellular biflagellated alga, Chlamydomonas reinhardtii Gametolysin is a zinc-containing metallo-protease, which is responsible for the degradation of the cell wall. Homologues of gametolysin have also been reported in the simple multicellular organism, Volvox [, ].
Probab=27.58  E-value=31  Score=33.89  Aligned_cols=17  Identities=41%  Similarity=0.460  Sum_probs=15.7

Q ss_pred             HHHHHhhhcCCCCCChh
Q 038987           52 TMLHELCHNDIAPHDAK   68 (316)
Q Consensus        52 vllHELaH~~~~~H~~~   68 (316)
                      |++|||-||.-..|+-.
T Consensus       153 ~~~HElgHN~GL~Ha~~  169 (314)
T PF05548_consen  153 TIMHELGHNLGLWHAGR  169 (314)
T ss_pred             HHHHHhhhhccccccCC
Confidence            99999999999999953


No 110
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=26.42  E-value=56  Score=35.93  Aligned_cols=49  Identities=10%  Similarity=0.360  Sum_probs=37.1

Q ss_pred             ccccCcceeccCCCCCCCCCCCCCCCCCceeeccCCcccCcCccccccCCC
Q 038987          266 MWECKACTFLNHGCGSVPHQGDASANDRVWTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       266 ~W~C~~CTllN~~C~~C~rPr~~~~~~~~WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      .-.|..|-++=. |..|.-+-.-......=.|++|.+. ...-..|.-||+
T Consensus       435 ~l~C~~Cg~v~~-Cp~Cd~~lt~H~~~~~L~CH~Cg~~-~~~p~~Cp~Cgs  483 (730)
T COG1198         435 LLLCRDCGYIAE-CPNCDSPLTLHKATGQLRCHYCGYQ-EPIPQSCPECGS  483 (730)
T ss_pred             eeecccCCCccc-CCCCCcceEEecCCCeeEeCCCCCC-CCCCCCCCCCCC
Confidence            457888876422 8888776544334567999999999 888899999985


No 111
>PF15641 Tox-MPTase5:  Metallopeptidase toxin 5
Probab=26.07  E-value=91  Score=25.99  Aligned_cols=38  Identities=21%  Similarity=0.350  Sum_probs=27.3

Q ss_pred             CCCCChHHHHHHHHHHhhhcCC-----CCC-------ChhHHHHHHHHHH
Q 038987           41 RESLPFHEVLDTMLHELCHNDI-----APH-------DAKFYKLWEELRE   78 (316)
Q Consensus        41 ~~flP~~~I~~vllHELaH~~~-----~~H-------~~~Fy~ll~~l~~   78 (316)
                      ..|.+...++.|++||=-|-.+     .+|       +.+||..++.++.
T Consensus        56 ~~f~sra~lr~~iiheelhhrw~~rgl~~hhp~gs~~~~~fy~~i~ry~~  105 (109)
T PF15641_consen   56 NSFSSRAELRNTIIHEELHHRWWKRGLNNHHPRGSEMSQRFYEIIRRYMS  105 (109)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHhhccccCCCCcchHHHHHHHHHHHHH
Confidence            3588889999999998666321     122       5689998887764


No 112
>PRK12496 hypothetical protein; Provisional
Probab=25.51  E-value=46  Score=29.65  Aligned_cols=9  Identities=33%  Similarity=0.427  Sum_probs=4.9

Q ss_pred             HHHHHHHHH
Q 038987          152 QAAAMAVEK  160 (316)
Q Consensus       152 e~aa~AAer  160 (316)
                      +++|.|.+-
T Consensus        82 ~~iaLA~el   90 (164)
T PRK12496         82 EVLALALEL   90 (164)
T ss_pred             HHHHHHHHh
Confidence            555555554


No 113
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=25.37  E-value=23  Score=39.43  Aligned_cols=48  Identities=17%  Similarity=0.350  Sum_probs=0.0

Q ss_pred             CCCCccccCcceeccCC--CCCCCCCCCCCCCCCceeeccCCcccCcCccccccCCC
Q 038987          262 EEPAMWECKACTFLNHG--CGSVPHQGDASANDRVWTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       262 ~~~~~W~C~~CTllN~~--C~~C~rPr~~~~~~~~WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      -....-.|+.|-..-..  |..|..+     ....|.|+-|..+-...  .|..|+.
T Consensus       651 vei~~r~Cp~Cg~~t~~~~Cp~CG~~-----T~~~~~Cp~C~~~~~~~--~C~~C~~  700 (900)
T PF03833_consen  651 VEIGRRRCPKCGKETFYNRCPECGSH-----TEPVYVCPDCGIEVEED--ECPKCGR  700 (900)
T ss_dssp             ---------------------------------------------------------
T ss_pred             EeeecccCcccCCcchhhcCcccCCc-----cccceeccccccccCcc--ccccccc
Confidence            34567889999887666  8888644     45579999999765544  8999874


No 114
>KOG3658 consensus Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases [Extracellular structures]
Probab=24.61  E-value=45  Score=36.49  Aligned_cols=45  Identities=24%  Similarity=0.200  Sum_probs=32.3

Q ss_pred             CCccEEEEeeecC--CCCCCCCChHHHHHHHHHHhhhcCCCCCChhH
Q 038987           25 GAGVHIKLLLRKL--NRDRESLPFHEVLDTMLHELCHNDIAPHDAKF   69 (316)
Q Consensus        25 N~G~~I~LRLR~~--~~~~~flP~~~I~~vllHELaH~~~~~H~~~F   69 (316)
                      |.|.++.|+.-..  -+-+.-.|...++-|++||+-||.-.+||..=
T Consensus       366 ~~G~~~sLNtGi~T~~NYg~~Vp~kvs~lt~AHEiGHNfGSpHDp~~  412 (764)
T KOG3658|consen  366 NEGKKRSLNTGISTSVNYGKRVPTKVSDLTLAHEIGHNFGSPHDPDI  412 (764)
T ss_pred             cCcceEEeecceeeeeecCCccCcchhheeehhhhccccCCCCCCCC
Confidence            3455565554322  12234688899999999999999999999764


No 115
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=24.49  E-value=46  Score=27.39  Aligned_cols=25  Identities=12%  Similarity=0.343  Sum_probs=17.1

Q ss_pred             CCCCCCCCCCCCCCCceeeccCCcc
Q 038987          279 CGSVPHQGDASANDRVWTCKFWTLE  303 (316)
Q Consensus       279 C~~C~rPr~~~~~~~~WsC~~CT~~  303 (316)
                      |..|.++..--.....|.|..|.+.
T Consensus        38 Cp~C~~~~VkR~a~GIW~C~kCg~~   62 (89)
T COG1997          38 CPFCGRTTVKRIATGIWKCRKCGAK   62 (89)
T ss_pred             CCCCCCcceeeeccCeEEcCCCCCe
Confidence            7777776433335568999999864


No 116
>COG3824 Predicted Zn-dependent protease [General function prediction only]
Probab=24.37  E-value=36  Score=29.77  Aligned_cols=14  Identities=29%  Similarity=0.662  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHhhhc
Q 038987           47 HEVLDTMLHELCHN   60 (316)
Q Consensus        47 ~~I~~vllHELaH~   60 (316)
                      +.|..|++||+.|-
T Consensus       107 d~vthvliHEIgHh  120 (136)
T COG3824         107 DQVTHVLIHEIGHH  120 (136)
T ss_pred             hHhhhhhhhhhhhh
Confidence            56889999999994


No 117
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=24.16  E-value=48  Score=29.75  Aligned_cols=19  Identities=32%  Similarity=0.309  Sum_probs=15.3

Q ss_pred             HHHHHHHHHhhhcCCCCCC
Q 038987           48 EVLDTMLHELCHNDIAPHD   66 (316)
Q Consensus        48 ~I~~vllHELaH~~~~~H~   66 (316)
                      ....|++|||-|.+--.|.
T Consensus        91 ~~~~~i~HElgHaLG~~HE  109 (198)
T cd04327          91 EFSRVVLHEFGHALGFIHE  109 (198)
T ss_pred             hHHHHHHHHHHHHhcCccc
Confidence            4568999999999866664


No 118
>PF07998 Peptidase_M54:  Peptidase family M54;  InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry represents zinc-dependent peptidases belonging to the MEROPS peptidase family M54, more commonly known as the archaemetzincins. The family has a wide taxonomic distribution, being found in archaea, bacteria and eukaryotes. Two human homologues have been characterised []. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 3LMC_A 2XHQ_A 2X7M_A.
Probab=23.49  E-value=52  Score=30.41  Aligned_cols=23  Identities=26%  Similarity=0.197  Sum_probs=15.9

Q ss_pred             hHHHHHHHHHHhhhcCCCCCChh
Q 038987           46 FHEVLDTMLHELCHNDIAPHDAK   68 (316)
Q Consensus        46 ~~~I~~vllHELaH~~~~~H~~~   68 (316)
                      .+.+..+++|||.|+.--+|=..
T Consensus       142 ~~R~~Kea~HElGH~~GL~HC~~  164 (194)
T PF07998_consen  142 LERVCKEAVHELGHLFGLDHCEN  164 (194)
T ss_dssp             HHHHHHHHHHHHHHHTT----SS
T ss_pred             HHHHHHHHHHHHHHHcCCcCCCC
Confidence            46677999999999998888544


No 119
>KOG3314 consensus Ku70-binding protein [Replication, recombination and repair]
Probab=22.83  E-value=89  Score=28.80  Aligned_cols=19  Identities=26%  Similarity=0.205  Sum_probs=15.8

Q ss_pred             CCChHHHHHHHHHHhhhcC
Q 038987           43 SLPFHEVLDTMLHELCHND   61 (316)
Q Consensus        43 flP~~~I~~vllHELaH~~   61 (316)
                      .+....+..|++|||-|..
T Consensus        85 l~~q~h~n~vv~HElIH~f  103 (194)
T KOG3314|consen   85 LTIQDHVNQVVIHELIHAF  103 (194)
T ss_pred             cchHHHHHHHHHHHHHHHH
Confidence            4556889999999999964


No 120
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
Probab=22.18  E-value=48  Score=34.76  Aligned_cols=34  Identities=18%  Similarity=0.082  Sum_probs=22.8

Q ss_pred             ccEEEEeeecCCCCCCCCChHHHHHHHHHHhhhcCCC
Q 038987           27 GVHIKLLLRKLNRDRESLPFHEVLDTMLHELCHNDIA   63 (316)
Q Consensus        27 G~~I~LRLR~~~~~~~flP~~~I~~vllHELaH~~~~   63 (316)
                      |..|-|+--..-   .--....|-.||.||+.|+..+
T Consensus       111 Gg~v~vntGLll---~ae~esElagViAHEigHv~qr  144 (484)
T COG4783         111 GGYVVVNTGLLL---TAENESELAGVIAHEIGHVAQR  144 (484)
T ss_pred             CceEEEehHHHH---hcCCHHHHHHHHHHHHHHHhhh
Confidence            666766643320   1123478999999999999765


No 121
>KOG2760 consensus Vacuolar sorting protein VPS36 [Intracellular trafficking, secretion, and vesicular transport]
Probab=22.00  E-value=60  Score=33.44  Aligned_cols=43  Identities=14%  Similarity=0.206  Sum_probs=26.7

Q ss_pred             CCCCCccccCcceeccCC-----CCCCCCCC-------CCCCCCCceeeccCCcc
Q 038987          261 PEEPAMWECKACTFLNHG-----CGSVPHQG-------DASANDRVWTCKFWTLE  303 (316)
Q Consensus       261 ~~~~~~W~C~~CTllN~~-----C~~C~rPr-------~~~~~~~~WsC~~CT~~  303 (316)
                      +.....|.|+.|+++|-.     |-.|.+--       .+.+....=-|++|||.
T Consensus        85 ~~~~~~~~~pls~vI~v~~~~~~~~~~g~~~~i~~~~~~~~~~~~~gp~~a~~~~  139 (432)
T KOG2760|consen   85 ADVEVTWVCPLSMVINVGEPAKSELTFGKINRIVVILHKPNPRFSPGPCPASTFA  139 (432)
T ss_pred             cccceeeeeceeEEEEecCccchhhcccccceEEEEeCCCCCcCCCCCcccceee
Confidence            344568999999999977     55543211       01112234678999875


No 122
>KOG1986 consensus Vesicle coat complex COPII, subunit SEC23 [Intracellular trafficking, secretion, and vesicular transport]
Probab=21.82  E-value=64  Score=35.42  Aligned_cols=40  Identities=25%  Similarity=0.536  Sum_probs=28.4

Q ss_pred             CCCCCCccccCcce-eccCCCCCCCCCCCCCCCCCceeeccCCcccCc
Q 038987          260 NPEEPAMWECKACT-FLNHGCGSVPHQGDASANDRVWTCKFWTLENCV  306 (316)
Q Consensus       260 ~~~~~~~W~C~~CT-llN~~C~~C~rPr~~~~~~~~WsC~~CT~~N~~  306 (316)
                      +.....+-.|..|. ++||-|.+ .      ...+.|.|.||-=.|..
T Consensus        47 ~~~~y~P~~C~~C~AvlNPyc~v-d------~~a~~W~CpfC~qrN~~   87 (745)
T KOG1986|consen   47 PPIQYDPLRCSKCGAVLNPYCSV-D------FRAKSWICPFCNQRNPF   87 (745)
T ss_pred             CccCCCCchhccchhhcCcceee-c------ccCceEeccccccCCCC
Confidence            34555677888885 67777887 2      13457999999888854


No 123
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=21.71  E-value=44  Score=30.25  Aligned_cols=21  Identities=24%  Similarity=0.820  Sum_probs=15.6

Q ss_pred             ccccCcceeccCC-----CCCCCCCC
Q 038987          266 MWECKACTFLNHG-----CGSVPHQG  286 (316)
Q Consensus       266 ~W~C~~CTllN~~-----C~~C~rPr  286 (316)
                      .|-|+.|-++=..     |.+|..|+
T Consensus       134 ~~vC~vCGy~~~ge~P~~CPiCga~k  159 (166)
T COG1592         134 VWVCPVCGYTHEGEAPEVCPICGAPK  159 (166)
T ss_pred             EEEcCCCCCcccCCCCCcCCCCCChH
Confidence            7999999886444     77776554


No 124
>PF13398 Peptidase_M50B:  Peptidase M50B-like
Probab=21.44  E-value=52  Score=29.86  Aligned_cols=15  Identities=40%  Similarity=0.483  Sum_probs=11.5

Q ss_pred             HHHHHHHHHhhhcCC
Q 038987           48 EVLDTMLHELCHNDI   62 (316)
Q Consensus        48 ~I~~vllHELaH~~~   62 (316)
                      .+..|++||+.|.+.
T Consensus        21 ~~l~t~~HE~gHal~   35 (200)
T PF13398_consen   21 RLLVTFVHELGHALA   35 (200)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            445599999999753


No 125
>PF10103 DUF2342:  Uncharacterised conserved protein (DUF2342);  InterPro: IPR018766 This entry represents a family of proteins whose function is currently unknown. These proteins are predominantly found in the actinobacteria (high GC Gram-positive bacteria), though some occur in other bacterial species and archaea. ; PDB: 3CMN_A.
Probab=20.92  E-value=58  Score=32.51  Aligned_cols=38  Identities=21%  Similarity=0.017  Sum_probs=28.4

Q ss_pred             CChHHHHHHHHHHhhhcCCCCCChhHHHHHHHHHHHHH
Q 038987           44 LPFHEVLDTMLHELCHNDIAPHDAKFYKLWEELREECD   81 (316)
Q Consensus        44 lP~~~I~~vllHELaH~~~~~H~~~Fy~ll~~l~~e~~   81 (316)
                      =|-+..+|+.+||.||-..-.|-+---..+.....+|-
T Consensus       152 ~~~d~rlwvalhE~aH~~lF~~~PWLr~~l~~~v~~~a  189 (342)
T PF10103_consen  152 DPDDFRLWVALHEAAHARLFAAVPWLRDHLLGAVEEYA  189 (342)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHHTSTHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHHHhhCchHHHHHHHHHHHHH
Confidence            34567789999999999988888766666666666653


No 126
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=20.91  E-value=63  Score=23.90  Aligned_cols=33  Identities=15%  Similarity=0.270  Sum_probs=18.5

Q ss_pred             ccccCcceeccCCCCCCCCCCCCCCCCCceeeccCCccc
Q 038987          266 MWECKACTFLNHGCGSVPHQGDASANDRVWTCKFWTLEN  304 (316)
Q Consensus       266 ~W~C~~CTllN~~C~~C~rPr~~~~~~~~WsC~~CT~~N  304 (316)
                      .--|+.|-..|-.    . |+. ....-+|.|.+|.+.|
T Consensus        22 aLIC~~C~~hNGl----a-~~~-~~~~i~y~C~~Cg~~N   54 (54)
T PF10058_consen   22 ALICSKCFSHNGL----A-PKE-EFEEIQYRCPYCGALN   54 (54)
T ss_pred             eEECcccchhhcc----c-ccc-cCCceEEEcCCCCCcC
Confidence            3456666665532    1 111 1133479999998877


No 127
>KOG1512 consensus PHD Zn-finger protein [General function prediction only]
Probab=20.60  E-value=34  Score=33.94  Aligned_cols=17  Identities=24%  Similarity=0.874  Sum_probs=12.7

Q ss_pred             ccccCcceeccCCCCCCCCCC
Q 038987          266 MWECKACTFLNHGCGSVPHQG  286 (316)
Q Consensus       266 ~W~C~~CTllN~~C~~C~rPr  286 (316)
                      .|+|..|-+    |..|..|.
T Consensus       308 ~W~C~~C~l----C~IC~~P~  324 (381)
T KOG1512|consen  308 FWKCSSCEL----CRICLGPV  324 (381)
T ss_pred             chhhcccHh----hhccCCcc
Confidence            799988887    66666664


No 128
>PF14247 DUF4344:  Domain of unknown function (DUF4344)
Probab=20.38  E-value=65  Score=30.31  Aligned_cols=20  Identities=45%  Similarity=0.448  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHhhhcCCCCCC
Q 038987           47 HEVLDTMLHELCHNDIAPHD   66 (316)
Q Consensus        47 ~~I~~vllHELaH~~~~~H~   66 (316)
                      ..+..|++||+.|..+...+
T Consensus        90 ~~~~~~l~HE~GHAlI~~~~  109 (220)
T PF14247_consen   90 GNVLFTLYHELGHALIDDLD  109 (220)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            45778999999998765544


No 129
>PRK14873 primosome assembly protein PriA; Provisional
Probab=20.06  E-value=70  Score=34.66  Aligned_cols=48  Identities=13%  Similarity=0.265  Sum_probs=32.6

Q ss_pred             ccccCcceeccCCCCCCCCCCCCCCCCCceeeccCCcccCcCccccccCCC
Q 038987          266 MWECKACTFLNHGCGSVPHQGDASANDRVWTCKFWTLENCVKLDKCSRVSK  316 (316)
Q Consensus       266 ~W~C~~CTllN~~C~~C~rPr~~~~~~~~WsC~~CT~~N~~~~~~C~~C~~  316 (316)
                      .-.|..|-..-. |..|.-|-........=.|+.|.+. . .-+.|..||.
T Consensus       383 ~l~C~~Cg~~~~-C~~C~~~L~~h~~~~~l~Ch~CG~~-~-~p~~Cp~Cgs  430 (665)
T PRK14873        383 SLACARCRTPAR-CRHCTGPLGLPSAGGTPRCRWCGRA-A-PDWRCPRCGS  430 (665)
T ss_pred             eeEhhhCcCeeE-CCCCCCceeEecCCCeeECCCCcCC-C-cCccCCCCcC
Confidence            457888865221 8888766543333456789999985 3 5789999984


Done!