BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039053
         (357 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2V8J|A Chain A, Structure Of A Family 2 Pectate Lyase In Complex With A
           Transition Metal
          Length = 535

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 217 VDVRTDGEAEWRINDEREVVVERTDDTNSVRVTVSGLLEM--DVKIRPIGAEENRTH--N 272
           VD RT  + EW   D R  V+       ++   +SGL ++  D + +    +  R H  N
Sbjct: 33  VDPRTGQQLEWIFPDGRRAVLSNFSAQQNLMRVMSGLSQLSGDPRYQKRAEDIVRYHFQN 92

Query: 273 YQLPAG 278
           YQ P+G
Sbjct: 93  YQDPSG 98


>pdb|2V8I|A Chain A, Structure Of A Family 2 Pectate Lyase In A Native Form
 pdb|2V8K|A Chain A, Structure Of A Family 2 Pectate Lyase In Complex With
           Trigalacturonic Acid
          Length = 543

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 4/66 (6%)

Query: 217 VDVRTDGEAEWRINDEREVVVERTDDTNSVRVTVSGLLEM--DVKIRPIGAEENRTH--N 272
           VD RT  + EW   D R  V+       ++   +SGL ++  D + +    +  R H  N
Sbjct: 34  VDPRTGQQLEWIFPDGRRAVLSNFSAQQNLMRVMSGLSQLSGDPRYQKRAEDIVRYHFQN 93

Query: 273 YQLPAG 278
           YQ P+G
Sbjct: 94  YQDPSG 99


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.426 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,129,906
Number of Sequences: 62578
Number of extensions: 474985
Number of successful extensions: 894
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 894
Number of HSP's gapped (non-prelim): 4
length of query: 357
length of database: 14,973,337
effective HSP length: 100
effective length of query: 257
effective length of database: 8,715,537
effective search space: 2239893009
effective search space used: 2239893009
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)