Citrus Sinensis ID: 039105


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490---
MDSNQSFSNNLLDDTVASLIERAQIGSLPSVIVIGGGISGLAAARILYDASFKVVLLESRDRLGGRIHTDYSFGCPVDMGASWLHGVCNENPLAPLIRRLGLTLYRTSGDNSVLYDHDLESYALYDMDGNKVEKEMAIKVGEIFKRILNETQKVRDEHTNDMSVLQAISIVLDRHPELRQEGLAYEVLQWYICRMEAWFAVDADMISLKCWDQEQVLSGGHGLMVQGYDPVIKALSKDIDIRLNQRVTKISNGCNKVMVTVEDGRNFVADAAIVTVPLGILKANLIQFEPKLPEWKLSAIADIGVGNENKIALRFDNVFWPNVELLGVVAPTSYACGYFLNLHKATGHPVLVYMAAGRFAYDLEKLSDESAANFVMMQLKKMFPDATEPVQYLVSRWGTDPNTLGCYSYDVVGMPGDLYERLRAPLGNLFFGGEAVSMEHQGSVHGAYSAGVMAAQNCQKYLLKQPGNLEKLQLVTLSHEILGTAFPLQISRM
cccccccccccccHHHHHHHHccccccccCEEEEcccHHHHHHHHHHHHccccEEEEEEcccccccCEEccccccccccccCEECcccccccHHHHHHHHcccEEEEcccccEEEEccccccCECccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccHHHcccccccccccccccccccHHHHHHHHHccccccccccEEEEEEccccEEEEEccccEEEccEEEEEcccHHHccccccccccccHHHHHHHHHcccccEEEEEEEccccccccccccEEEcccccccEEEEcccccccccEEEEEEccHHHHHHHcccHHHHHHHHHHHHHHHccccccccEEEEcccccccccccccccccccccHHHHHHHHcccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHcccccccccccccc
***********LDDTVASLIERAQIGSLPSVIVIGGGISGLAAARILYDASFKVVLLESRDRLGGRIHTDYSFGCPVDMGASWLHGVCNENPLAPLIRRLGLTLYRTSGDNSVLYDHDLESYALYDMDGNKVEKEMAIKVGEIFKRILNETQKVRDEHTNDMSVLQAISIVLDRHPELRQEGLAYEVLQWYICRMEAWFAVDADMISLKCWDQEQVLSGGHGLMVQGYDPVIKALSKDIDIRLNQRVTKISNGCNKVMVTVEDGRNFVADAAIVTVPLGILKANLIQFEPKLPEWKLSAIADIGVGNENKIALRFDNVFWPNVELLGVVAPTSYACGYFLNLHKATGHPVLVYMAAGRFAYDLEKLSDESAANFVMMQLKKMFPDATEPVQYLVSRWGTDPNTLGCYSYDVVGMPGDLYERLRAPLGNLFFGGEAVSMEHQGSVHGAYSAGVMAAQNCQKYLLKQPGNLE**QLVTLSHEILGTAFPLQISRM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSNQSFSNNLLDDTVASLIERAQIGSLPSVIVIGGGISGLAAARILYDASFKVVLLESRDRLGGRIHTDYSFGCPVDMGASWLHGVCNENPLAPLIRRLGLTLYRTSGDNSVLYDHDLESYALYDMDGNKVEKEMAIKVGEIFKRILNETQKVRDEHTNDMSVLQAISIVLDRHPELRQEGLAYEVLQWYICRMEAWFAVDADMISLKCWDQEQVLSGGHGLMVQGYDPVIKALSKDIDIRLNQRVTKISNGCNKVMVTVEDGRNFVADAAIVTVPLGILKANLIQFEPKLPEWKLSAIADIGVGNENKIALRFDNVFWPNVELLGVVAPTSYACGYFLNLHKATGHPVLVYMAAGRFAYDLEKLSDESAANFVMMQLKKMFPDATEPVQYLVSRWGTDPNTLGCYSYDVVGMPGDLYERLRAPLGNLFFGGEAVSMEHQGSVHGAYSAGVMAAQNCQKYLLKQPGNLEKLQLVTLSHEILGTAFPLQISRM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable polyamine oxidase 4 Flavoenzyme that catalyzes the oxidation of the secondary amino group of spermine. No activity detected when spermidine, putrescine or N(1)-acetylspermine are used as substrates.confidentQ8H191

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.5.-.-Acting on the CH-NH group of donors.probable
1.5.3.-With oxygen as acceptor.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RSG, chain A
Confidence level:very confident
Coverage over the Query: 45-465
View the alignment between query and template
View the model in PyMOL