BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039155
(206 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3IC9|A Chain A, The Structure Of Dihydrolipoamide Dehydrogenase From
Colwellia Psychrerythraea 34h.
pdb|3IC9|B Chain B, The Structure Of Dihydrolipoamide Dehydrogenase From
Colwellia Psychrerythraea 34h.
pdb|3IC9|C Chain C, The Structure Of Dihydrolipoamide Dehydrogenase From
Colwellia Psychrerythraea 34h.
pdb|3IC9|D Chain D, The Structure Of Dihydrolipoamide Dehydrogenase From
Colwellia Psychrerythraea 34h
Length = 492
Score = 27.7 bits (60), Expect = 4.8, Method: Compositional matrix adjust.
Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 6/50 (12%)
Query: 114 LGVVRTSPLVAALGVSLTIPLAMLEDMFIHHQHYSPIYIIGSVQNSSQNR 163
L VV T P VA++G+SL +ED++ + Y++G V Q R
Sbjct: 350 LSVVFTEPQVASVGLSLR----QIEDLYADQD--AANYVVGQVSFEGQGR 393
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.136 0.440
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,071,848
Number of Sequences: 62578
Number of extensions: 226490
Number of successful extensions: 772
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 772
Number of HSP's gapped (non-prelim): 1
length of query: 206
length of database: 14,973,337
effective HSP length: 94
effective length of query: 112
effective length of database: 9,091,005
effective search space: 1018192560
effective search space used: 1018192560
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)