BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039165
(956 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2OKX|A Chain A, Crystal Structure Of Gh78 Family Rhamnosidase Of Bacillus
Sp. Gl1 At 1.9 A
pdb|2OKX|B Chain B, Crystal Structure Of Gh78 Family Rhamnosidase Of Bacillus
Sp. Gl1 At 1.9 A
Length = 956
Score = 31.2 bits (69), Expect = 3.0, Method: Compositional matrix adjust.
Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 5/64 (7%)
Query: 620 NEMNAYNIHDTSQWKDLNPK---FVLQVYRDFAA-TGDMSFGVDVWPAVRAAM-EYMEQF 674
+E Y S W + P F + R++AA TG+ +F +WPAV+ + Y+E
Sbjct: 609 DETPLYLDQVPSAWSSVIPNWTFFWILACREYAAHTGNEAFAARIWPAVKHTLTHYLEHI 668
Query: 675 DRDG 678
D G
Sbjct: 669 DDSG 672
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.135 0.434
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31,263,539
Number of Sequences: 62578
Number of extensions: 1375499
Number of successful extensions: 2313
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2313
Number of HSP's gapped (non-prelim): 1
length of query: 956
length of database: 14,973,337
effective HSP length: 108
effective length of query: 848
effective length of database: 8,214,913
effective search space: 6966246224
effective search space used: 6966246224
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)