BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039165
         (956 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2OKX|A Chain A, Crystal Structure Of Gh78 Family Rhamnosidase Of Bacillus
           Sp. Gl1 At 1.9 A
 pdb|2OKX|B Chain B, Crystal Structure Of Gh78 Family Rhamnosidase Of Bacillus
           Sp. Gl1 At 1.9 A
          Length = 956

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 5/64 (7%)

Query: 620 NEMNAYNIHDTSQWKDLNPK---FVLQVYRDFAA-TGDMSFGVDVWPAVRAAM-EYMEQF 674
           +E   Y     S W  + P    F +   R++AA TG+ +F   +WPAV+  +  Y+E  
Sbjct: 609 DETPLYLDQVPSAWSSVIPNWTFFWILACREYAAHTGNEAFAARIWPAVKHTLTHYLEHI 668

Query: 675 DRDG 678
           D  G
Sbjct: 669 DDSG 672


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.434 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 31,263,539
Number of Sequences: 62578
Number of extensions: 1375499
Number of successful extensions: 2313
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2313
Number of HSP's gapped (non-prelim): 1
length of query: 956
length of database: 14,973,337
effective HSP length: 108
effective length of query: 848
effective length of database: 8,214,913
effective search space: 6966246224
effective search space used: 6966246224
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)