BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039199
(180 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|A7EMM3|NST1_SCLS1 Stress response protein nst1 OS=Sclerotinia sclerotiorum (strain ATCC
18683 / 1980 / Ss-1) GN=nst1 PE=3 SV=1
Length = 1171
Score = 30.8 bits (68), Expect = 5.2, Method: Composition-based stats.
Identities = 18/62 (29%), Positives = 26/62 (41%)
Query: 91 APRSAPRSYGNSRTNIYINPPVAPPLVGGYGYGSYYGGWGWSPFSFFVPGPSVAIGLGGG 150
PR + + GNS ++ PP G S +G WG P F + G GGG
Sbjct: 969 GPRRSSAAPGNSSRQNFLPPPFGMDRSDPAGMMSSFGTWGAPPNPFGSSSLPGSNGFGGG 1028
Query: 151 FD 152
++
Sbjct: 1029 WN 1030
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.319 0.136 0.413
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 70,437,727
Number of Sequences: 539616
Number of extensions: 3091405
Number of successful extensions: 8940
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 53
Number of HSP's that attempted gapping in prelim test: 8840
Number of HSP's gapped (non-prelim): 139
length of query: 180
length of database: 191,569,459
effective HSP length: 110
effective length of query: 70
effective length of database: 132,211,699
effective search space: 9254818930
effective search space used: 9254818930
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)