Query         039200
Match_columns 88
No_of_seqs    128 out of 1010
Neff          6.7 
Searched_HMMs 46136
Date          Fri Mar 29 07:17:20 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/039200.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/039200hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1196 Predicted NAD-dependen  99.9 6.1E-25 1.3E-29  162.0   7.0   81    7-88      1-81  (343)
  2 COG2130 Putative NADP-dependen  99.9 2.2E-24 4.8E-29  159.2   6.1   74    9-88      8-81  (340)
  3 PLN03154 putative allyl alcoho  99.6 4.8E-15   1E-19  109.3   7.8   80    4-85      3-83  (348)
  4 cd08295 double_bond_reductase_  98.9 1.1E-08 2.3E-13   74.5   7.8   77    8-85      1-78  (338)
  5 cd08293 PTGR2 Prostaglandin re  98.6 1.8E-07 3.9E-12   67.8   7.3   55    8-65      1-57  (345)
  6 TIGR02825 B4_12hDH leukotriene  98.6 8.9E-08 1.9E-12   69.2   5.6   51   10-64      1-51  (325)
  7 cd05288 PGDH Prostaglandin deh  98.3   2E-06 4.4E-11   61.6   6.6   54    9-66      1-54  (329)
  8 cd08294 leukotriene_B4_DH_like  97.8 5.2E-05 1.1E-09   54.3   5.4   49   10-62      3-51  (329)
  9 TIGR01202 bchC 2-desacetyl-2-h  93.0     0.3 6.5E-06   35.3   5.3   29   26-58     11-39  (308)
 10 cd08234 threonine_DH_like L-th  93.0    0.51 1.1E-05   33.8   6.5   35   27-65     11-45  (334)
 11 cd08273 MDR8 Medium chain dehy  91.4     1.1 2.3E-05   31.9   6.6   43   10-60      1-43  (331)
 12 PRK05396 tdh L-threonine 3-deh  91.3    0.57 1.2E-05   33.9   5.2   30   26-59     11-40  (341)
 13 cd08291 ETR_like_1 2-enoyl thi  91.2    0.86 1.9E-05   32.8   5.9   49   11-64      2-50  (324)
 14 cd08301 alcohol_DH_plants Plan  91.1    0.78 1.7E-05   33.8   5.8   41    9-59      2-42  (369)
 15 cd08281 liver_ADH_like1 Zinc-d  90.1     1.6 3.4E-05   32.3   6.7   47   11-61      2-50  (371)
 16 cd08277 liver_alcohol_DH_like   89.8     1.2 2.6E-05   32.8   5.8   41    9-59      2-42  (365)
 17 cd08236 sugar_DH NAD(P)-depend  89.6     1.9 4.1E-05   31.0   6.6   43   11-64      2-44  (343)
 18 TIGR02823 oxido_YhdH putative   89.5    0.99 2.2E-05   32.1   5.0   41   11-59      1-41  (323)
 19 cd08230 glucose_DH Glucose deh  89.1     1.2 2.6E-05   32.6   5.3   35   28-66     13-47  (355)
 20 COG0604 Qor NADPH:quinone redu  89.0    0.73 1.6E-05   34.3   4.2   31   25-59     12-42  (326)
 21 cd08237 ribitol-5-phosphate_DH  89.0    0.82 1.8E-05   33.5   4.4   31   26-61     12-42  (341)
 22 cd08233 butanediol_DH_like (2R  89.0     1.1 2.5E-05   32.5   5.1   38   11-59      2-39  (351)
 23 cd08288 MDR_yhdh Yhdh putative  88.7     1.3 2.9E-05   31.4   5.2   41   11-59      2-42  (324)
 24 TIGR02822 adh_fam_2 zinc-bindi  88.0     2.8 6.1E-05   30.6   6.7   37   21-61      8-44  (329)
 25 cd08270 MDR4 Medium chain dehy  87.7     1.7 3.6E-05   30.5   5.2   40   11-59      2-41  (305)
 26 cd05282 ETR_like 2-enoyl thioe  87.2     1.8 3.9E-05   30.6   5.1   40   21-64      7-46  (323)
 27 cd08259 Zn_ADH5 Alcohol dehydr  85.5     2.6 5.7E-05   29.8   5.3   39   11-59      2-40  (332)
 28 TIGR02817 adh_fam_1 zinc-bindi  85.1     2.1 4.5E-05   30.6   4.6   31   25-59     14-44  (336)
 29 PLN02740 Alcohol dehydrogenase  84.2     4.1   9E-05   30.3   6.0   44    6-59      7-50  (381)
 30 TIGR01751 crot-CoA-red crotony  84.2     2.5 5.4E-05   31.6   4.9   45    9-58      7-51  (398)
 31 cd08290 ETR 2-enoyl thioester   84.0     2.2 4.8E-05   30.6   4.4   43   11-59      2-44  (341)
 32 cd08276 MDR7 Medium chain dehy  83.9     7.1 0.00015   27.5   6.9   45   11-63      2-46  (336)
 33 cd08300 alcohol_DH_class_III c  83.8     4.2 9.1E-05   30.0   5.9   29   27-59     14-42  (368)
 34 cd08278 benzyl_alcohol_DH Benz  83.5     3.5 7.6E-05   30.4   5.3   41    9-59      2-42  (365)
 35 cd08250 Mgc45594_like Mgc45594  83.4     7.4 0.00016   27.7   6.9   43   11-59      3-45  (329)
 36 cd08239 THR_DH_like L-threonin  83.3     3.7 8.1E-05   29.6   5.3   30   26-59     10-39  (339)
 37 cd08252 AL_MDR Arginate lyase   82.7     3.3 7.1E-05   29.5   4.8   45   11-60      2-46  (336)
 38 TIGR03451 mycoS_dep_FDH mycoth  82.5     4.9 0.00011   29.4   5.8   40   11-60      3-42  (358)
 39 cd08240 6_hydroxyhexanoate_dh_  82.3     3.7 8.1E-05   29.7   5.0   28   28-59     13-40  (350)
 40 cd08267 MDR1 Medium chain dehy  82.1     2.2 4.7E-05   29.9   3.6   33   28-64     14-46  (319)
 41 cd08262 Zn_ADH8 Alcohol dehydr  82.0     3.7 8.1E-05   29.5   4.9   29   27-59     10-38  (341)
 42 cd08232 idonate-5-DH L-idonate  81.6     2.9 6.3E-05   30.0   4.2   31   25-59      6-36  (339)
 43 cd05278 FDH_like Formaldehyde   81.4     4.4 9.5E-05   29.1   5.1   31   27-60     11-41  (347)
 44 PRK09880 L-idonate 5-dehydroge  81.2     4.8  0.0001   29.3   5.3   32   26-62     14-45  (343)
 45 cd08235 iditol_2_DH_like L-idi  81.1     4.8  0.0001   28.9   5.2   38   11-59      2-39  (343)
 46 cd08298 CAD2 Cinnamyl alcohol   81.0     5.7 0.00012   28.3   5.5   43   11-59      2-44  (329)
 47 cd05280 MDR_yhdh_yhfp Yhdh and  80.7     5.5 0.00012   28.1   5.3   36   26-65     13-48  (325)
 48 PRK10754 quinone oxidoreductas  80.4     4.1 8.9E-05   29.0   4.6   41   11-59      3-43  (327)
 49 PLN02827 Alcohol dehydrogenase  80.2     6.4 0.00014   29.4   5.7   30   26-59     23-52  (378)
 50 cd08297 CAD3 Cinnamyl alcohol   80.2     5.9 0.00013   28.4   5.4   31   25-59     11-41  (341)
 51 cd08299 alcohol_DH_class_I_II_  80.0     7.6 0.00016   28.8   6.0   45    5-59      3-47  (373)
 52 PLN02514 cinnamyl-alcohol dehy  79.8     4.9 0.00011   29.6   5.0   41   11-61     11-51  (357)
 53 PRK13771 putative alcohol dehy  79.7     5.6 0.00012   28.4   5.2   29   27-59     12-40  (334)
 54 cd08242 MDR_like Medium chain   79.1      10 0.00022   26.9   6.3   38   11-59      2-39  (319)
 55 cd08246 crotonyl_coA_red croto  78.3     5.2 0.00011   29.7   4.7   46    8-58     11-56  (393)
 56 cd08238 sorbose_phosphate_red   78.3     5.1 0.00011   30.2   4.7   29   27-59     13-41  (410)
 57 PRK10309 galactitol-1-phosphat  78.1     4.5 9.8E-05   29.4   4.3   30   27-59     11-40  (347)
 58 cd08269 Zn_ADH9 Alcohol dehydr  77.5     4.4 9.6E-05   28.4   4.0   30   26-59      5-34  (312)
 59 cd08258 Zn_ADH4 Alcohol dehydr  77.4     8.6 0.00019   27.5   5.5   32   26-61     12-43  (306)
 60 cd08256 Zn_ADH2 Alcohol dehydr  77.1     4.8  0.0001   29.2   4.2   31   26-60     10-40  (350)
 61 cd08287 FDH_like_ADH3 formalde  75.7     5.3 0.00012   28.7   4.1   31   27-60     11-41  (345)
 62 cd08272 MDR6 Medium chain dehy  75.7       8 0.00017   26.9   4.9   42   11-60      2-43  (326)
 63 cd08231 MDR_TM0436_like Hypoth  75.5     9.8 0.00021   27.7   5.5   31   26-60     11-41  (361)
 64 cd05276 p53_inducible_oxidored  75.3      20 0.00043   24.7   6.8   41   11-59      2-42  (323)
 65 cd08271 MDR5 Medium chain dehy  75.0     9.4  0.0002   26.7   5.1   35   26-64     13-47  (325)
 66 cd08286 FDH_like_ADH2 formalde  74.8     9.4  0.0002   27.5   5.2   32   27-61     11-42  (345)
 67 cd08263 Zn_ADH10 Alcohol dehyd  74.6      11 0.00025   27.5   5.6   39   11-59      2-40  (367)
 68 PRK10083 putative oxidoreducta  73.7      11 0.00023   27.1   5.2   30   26-59     10-39  (339)
 69 PTZ00354 alcohol dehydrogenase  73.4      12 0.00025   26.5   5.3   41   11-59      3-43  (334)
 70 cd08289 MDR_yhfp_like Yhfp put  73.3      11 0.00024   26.7   5.2   41   11-59      2-42  (326)
 71 PF08240 ADH_N:  Alcohol dehydr  73.3     6.7 0.00014   24.0   3.6   23   44-66      1-23  (109)
 72 cd08283 FDH_like_1 Glutathione  72.6      11 0.00024   28.1   5.2   31   26-59     10-40  (386)
 73 TIGR03201 dearomat_had 6-hydro  72.4     6.3 0.00014   28.8   3.8   28   28-59     11-38  (349)
 74 cd08248 RTN4I1 Human Reticulon  71.5     5.3 0.00011   28.7   3.2   34   27-63     15-48  (350)
 75 cd05283 CAD1 Cinnamyl alcohol   71.5     7.5 0.00016   28.1   4.0   30   26-59     10-39  (337)
 76 cd08249 enoyl_reductase_like e  71.2       5 0.00011   29.1   3.0   32   25-60     11-42  (339)
 77 cd05281 TDH Threonine dehydrog  71.0     7.9 0.00017   27.9   4.0   29   27-59     12-40  (341)
 78 cd05284 arabinose_DH_like D-ar  71.0     7.8 0.00017   27.7   4.0   29   27-59     12-40  (340)
 79 cd08284 FDH_like_2 Glutathione  69.9      14 0.00031   26.4   5.2   30   27-59     11-40  (344)
 80 cd08275 MDR3 Medium chain dehy  68.9      33 0.00072   24.0   6.8   30   26-59     12-41  (337)
 81 cd08243 quinone_oxidoreductase  68.5      17 0.00036   25.3   5.2   30   26-59     13-42  (320)
 82 cd08261 Zn_ADH7 Alcohol dehydr  68.2      16 0.00035   26.1   5.2   39   11-60      2-40  (337)
 83 cd05285 sorbitol_DH Sorbitol d  68.1      11 0.00023   27.3   4.2   30   26-59      8-37  (343)
 84 TIGR00692 tdh L-threonine 3-de  67.8     9.2  0.0002   27.6   3.8   28   28-59     11-38  (340)
 85 cd08292 ETR_like_2 2-enoyl thi  67.6      24 0.00052   24.8   5.9   42   11-59      2-43  (324)
 86 PRK09422 ethanol-active dehydr  67.6      11 0.00025   26.9   4.2   26   30-59     15-40  (338)
 87 cd05289 MDR_like_2 alcohol deh  67.5      15 0.00032   25.3   4.7   35   26-64     13-47  (309)
 88 COG1064 AdhP Zn-dependent alco  66.4      19 0.00041   27.5   5.4   25   28-56     16-40  (339)
 89 PLN02702 L-idonate 5-dehydroge  65.4      22 0.00047   26.0   5.4   30   26-59     27-56  (364)
 90 cd08244 MDR_enoyl_red Possible  65.0      20 0.00044   25.1   5.1   41   11-59      2-42  (324)
 91 PLN02586 probable cinnamyl alc  65.0      19 0.00041   26.6   5.1   43    7-59     10-52  (360)
 92 cd08282 PFDH_like Pseudomonas   63.1      15 0.00031   27.2   4.2   30   27-59     11-40  (375)
 93 cd08285 NADP_ADH NADP(H)-depen  62.8      15 0.00034   26.5   4.2   29   27-59     11-39  (351)
 94 cd05279 Zn_ADH1 Liver alcohol   62.8      25 0.00053   25.9   5.3   29   27-59     12-40  (365)
 95 TIGR02819 fdhA_non_GSH formald  62.8      22 0.00048   26.8   5.2   39   26-65     12-54  (393)
 96 cd08260 Zn_ADH6 Alcohol dehydr  62.3      25 0.00053   25.3   5.2   39   11-59      2-40  (345)
 97 cd08247 AST1_like AST1 is a cy  61.7      14 0.00029   26.8   3.8   33   29-62     14-46  (352)
 98 cd08264 Zn_ADH_like2 Alcohol d  60.3      17 0.00037   25.8   4.0   30   26-59     12-41  (325)
 99 TIGR02818 adh_III_F_hyde S-(hy  59.1      17 0.00037   26.8   3.9   29   27-59     13-41  (368)
100 cd08265 Zn_ADH3 Alcohol dehydr  57.4      20 0.00043   26.6   4.0   29   27-59     38-66  (384)
101 cd08245 CAD Cinnamyl alcohol d  56.6      19 0.00042   25.6   3.8   29   27-59     11-39  (330)
102 cd08296 CAD_like Cinnamyl alco  56.3      21 0.00046   25.6   4.0   29   27-59     12-40  (333)
103 cd08253 zeta_crystallin Zeta-c  55.8      39 0.00084   23.3   5.1   30   26-59     13-42  (325)
104 cd08279 Zn_ADH_class_III Class  55.2      25 0.00053   25.8   4.2   28   28-59     13-40  (363)
105 cd08266 Zn_ADH_like1 Alcohol d  53.8      23  0.0005   24.8   3.7   30   26-59     13-42  (342)
106 PLN02178 cinnamyl-alcohol dehy  53.0      43 0.00093   25.0   5.3   29   27-59     18-46  (375)
107 cd08254 hydroxyacyl_CoA_DH 6-h  46.6      47   0.001   23.4   4.4   29   28-60     14-42  (338)
108 COG1062 AdhC Zn-dependent alco  46.3      37 0.00079   26.3   4.0   34   26-63     13-49  (366)
109 cd08268 MDR2 Medium chain dehy  41.7 1.2E+02  0.0025   21.0   6.7   30   26-59     13-42  (328)
110 cd08241 QOR1 Quinone oxidoredu  41.2      87  0.0019   21.5   5.0   30   26-59     13-42  (323)
111 KOG1198 Zinc-binding oxidoredu  40.3      62  0.0014   24.5   4.4   47    9-62      4-50  (347)
112 KOG3451 Uncharacterized conser  38.2      18 0.00039   21.6   1.0   15   52-66      8-22  (71)
113 cd05286 QOR2 Quinone oxidoredu  34.4      67  0.0014   22.0   3.6   30   26-59     12-41  (320)
114 PF04648 MF_alpha:  Yeast matin  32.9      18 0.00039   14.8   0.3    6   53-58      3-8   (13)
115 PF10736 DUF2527:  Protein of u  31.5      22 0.00048   18.5   0.6   15   52-66     18-32  (38)
116 TIGR02824 quinone_pig3 putativ  30.6   1E+02  0.0022   21.2   4.0   30   26-59     13-42  (325)
117 COG3085 Uncharacterized protei  29.6      15 0.00034   23.5  -0.3   28    8-35      7-34  (112)
118 PF06331 Tbf5:  Transcription f  29.6      37 0.00081   20.0   1.4   16   49-64      5-20  (68)
119 KOG0022 Alcohol dehydrogenase,  28.2 1.1E+02  0.0024   23.7   4.0   29   27-59     19-47  (375)
120 KOG1197 Predicted quinone oxid  28.0      55  0.0012   24.8   2.3   48    9-64      8-58  (336)
121 PF03345 DDOST_48kD:  Oligosacc  27.8      34 0.00073   26.9   1.3   33   45-79    305-341 (423)
122 KOG2754 Oligosaccharyltransfer  25.9      43 0.00093   26.4   1.5   32   49-80    332-363 (443)
123 PF05958 tRNA_U5-meth_tr:  tRNA  25.8      39 0.00085   25.4   1.3   14   50-63    304-317 (352)
124 PF02630 SCO1-SenC:  SCO1/SenC;  24.8      53  0.0012   22.0   1.7   11   49-59     89-99  (174)
125 COG1999 Uncharacterized protei  24.7      57  0.0012   22.8   1.8   14   46-59    102-115 (207)
126 PF09493 DUF2389:  Tryptophan-r  24.0 1.2E+02  0.0026   17.2   2.8   33   25-65     13-45  (60)
127 PF11826 DUF3346:  Protein of u  23.0      54  0.0012   23.5   1.4   45   11-56     11-59  (225)

No 1  
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only]
Probab=99.91  E-value=6.1e-25  Score=162.03  Aligned_cols=81  Identities=49%  Similarity=0.840  Sum_probs=73.4

Q ss_pred             ceeeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhccCCCCCCccCCCCCCCceeccc
Q 039200            7 AVSNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERMSKLDRPSFVDSFHPGGVSSSRP   86 (88)
Q Consensus         7 ~~~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~~~~~~~Y~~p~~~G~~m~g~~   86 (88)
                      |+.|+||+|+++++|+|+.+||+++++++.+..+.++ +++||||||||||||||.||++.+..+|++|+.+|+++.|++
T Consensus         1 ~v~nkqvvLk~y~~g~P~~~d~~~~~~~~el~~~~~s-~~vlvknlYLS~DPymR~rM~~~~~~~y~~~~~~G~pi~g~G   79 (343)
T KOG1196|consen    1 MVTNKQVILKNYVTGFPTESDFEFTTTTVELRVPLGS-GEVLVKNLYLSCDPYMRIRMGKPDPSDYAPPYEPGKPIDGFG   79 (343)
T ss_pred             CccccEEEEeccCCCCCccccceeeeeeecccCCCCC-ccEEeEeeeecCCHHHHhhccCCCcccccCcccCCcEecCCc
Confidence            4689999999999999999999999988766566687 999999999999999999999876556999999999999999


Q ss_pred             CC
Q 039200           87 IS   88 (88)
Q Consensus        87 Vg   88 (88)
                      ||
T Consensus        80 V~   81 (343)
T KOG1196|consen   80 VA   81 (343)
T ss_pred             eE
Confidence            86


No 2  
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only]
Probab=99.90  E-value=2.2e-24  Score=159.24  Aligned_cols=74  Identities=34%  Similarity=0.604  Sum_probs=68.5

Q ss_pred             eeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhccCCCCCCccCCCCCCCceecccCC
Q 039200            9 SNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERMSKLDRPSFVDSFHPGGVSSSRPIS   88 (88)
Q Consensus         9 ~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~~~~~~~Y~~p~~~G~~m~g~~Vg   88 (88)
                      .|++|+|+.||.|.|..++|+++|.++|  .| ++ ||+|+||+|+|+|||||+||++.  +||++|+++|++|.|.+||
T Consensus         8 ~~~~~~la~rP~g~p~~d~F~lee~~vp--~p-~~-GqvLl~~~ylS~DPymRgrm~d~--~SY~~P~~lG~~~~gg~V~   81 (340)
T COG2130           8 VNRRIVLASRPEGAPVPDDFRLEEVDVP--EP-GE-GQVLLRTLYLSLDPYMRGRMSDA--PSYAPPVELGEVMVGGTVA   81 (340)
T ss_pred             hhheeeeccCCCCCCCCCCceeEeccCC--CC-Cc-CceEEEEEEeccCHHHeecccCC--cccCCCcCCCceeECCeeE
Confidence            3699999999999999999999999997  34 77 99999999999999999999986  4999999999999999885


No 3  
>PLN03154 putative allyl alcohol dehydrogenase; Provisional
Probab=99.59  E-value=4.8e-15  Score=109.33  Aligned_cols=80  Identities=48%  Similarity=0.843  Sum_probs=63.5

Q ss_pred             cccceeeeEEEEccCCCCCCCCCCcEEEEe-ecccccCCCCCCeEEEEeEEEeeCcchhhhccCCCCCCccCCCCCCCce
Q 039200            4 EQEAVSNKRVILSNYVTGFPNESDMKITSG-SIKLKVADGSKDTVLLKNLYLSCGPYMRERMSKLDRPSFVDSFHPGGVS   82 (88)
Q Consensus         4 ~~~~~~n~~vvl~~~P~g~p~~~~f~l~~~-~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~~~~~~~Y~~p~~~G~~m   82 (88)
                      ||+.++||+|+|++||+|.|+++||++++. +++.+.++++ ||||||+.+.|+||+.|.++.... ..|.+|+.+|..+
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~-gevlVkv~a~~inp~~~~~~~~~~-~~~~~p~~~G~~~   80 (348)
T PLN03154          3 EGQVVENKQVILKNYIDGIPKETDMEVKLGNKIELKAPKGS-GAFLVKNLYLSCDPYMRGRMRDFH-DSYLPPFVPGQRI   80 (348)
T ss_pred             CCccccceEEEEecCCCCCCCcccEEEEeecccCCCCCCCC-CeEEEEEEEEccCHHHHHhhhccC-CCCCCCcCCCCee
Confidence            678899999999999999999999999996 2443334466 999999999999999999886421 2455677788766


Q ss_pred             ecc
Q 039200           83 SSR   85 (88)
Q Consensus        83 ~g~   85 (88)
                      .|.
T Consensus        81 ~~~   83 (348)
T PLN03154         81 EGF   83 (348)
T ss_pred             Eee
Confidence            543


No 4  
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. This group includes proteins identified as the Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase.  The Arabidopsis enzyme, a member of the medium chain dehydrogenase/reductase family, catalyzes the reduction of 7-8-double bond of phenylpropanal substrates as a plant defense mechanism.  Prostaglandins and related eicosanoids (lipid mediators involved in host defense and inflamation) are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. Leukotriene B4 (LTB4) can be metabolized by LTB4 20-hydroxylase in
Probab=98.87  E-value=1.1e-08  Score=74.50  Aligned_cols=77  Identities=52%  Similarity=0.893  Sum_probs=57.4

Q ss_pred             eeeeEEEEccCCCCCCCCCCcEEEEeecccccC-CCCCCeEEEEeEEEeeCcchhhhccCCCCCCccCCCCCCCceecc
Q 039200            8 VSNKRVILSNYVTGFPNESDMKITSGSIKLKVA-DGSKDTVLLKNLYLSCGPYMRERMSKLDRPSFVDSFHPGGVSSSR   85 (88)
Q Consensus         8 ~~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~-~~~~gevLvr~l~lSvDPy~R~~m~~~~~~~Y~~p~~~G~~m~g~   85 (88)
                      +.||+++++..-.+.|..++|++++.++|++.| +++ ||||||+.+.+++|+.+.++.......|.+|+.+|..+.|.
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~p~~-~~vlv~v~~~~inp~d~~~~~g~~~~~~~~p~~~g~~~~g~   78 (338)
T cd08295           1 VRNKQVILKAYVTGFPKESDLELRTTKLTLKVPPGGS-GDVLVKNLYLSCDPYMRGRMKGHDDSLYLPPFKPGEVITGY   78 (338)
T ss_pred             CcceEEEEecCCCCCCCccceEEEEecCCcCCCCCCC-CeEEEEEEEEeeCHHHHHhhccCCccccCCCcCCCCeEecc
Confidence            368999999988877789999999999864433 366 99999999999999998877642111144567777555443


No 5  
>cd08293 PTGR2 Prostaglandin reductase. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acid
Probab=98.61  E-value=1.8e-07  Score=67.80  Aligned_cols=55  Identities=35%  Similarity=0.587  Sum_probs=46.3

Q ss_pred             eeeeEEEEccCC--CCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhcc
Q 039200            8 VSNKRVILSNYV--TGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERMS   65 (88)
Q Consensus         8 ~~n~~vvl~~~P--~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~   65 (88)
                      |.||+++|+++|  .|.|.++.|++++.+.|  .|.++ ||||||+.+.+++|+.|..+.
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p--~~~~~-~evlV~v~a~gin~~d~~~~~   57 (345)
T cd08293           1 MINKRVVLNSRPGKNGNPVAENFRVEECTLP--DELNE-GQVLVRTLYLSVDPYMRCRMN   57 (345)
T ss_pred             CcceEEEEecccCCCCCCCccceEEEeccCC--CCCCC-CeEEEEEEEEecCHHHHhhcc
Confidence            358999999999  78999999999888776  33235 899999999999999886654


No 6  
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase. Leukotriene B4 12-hydroxydehydrogenase is an NADP-dependent enzyme of arachidonic acid metabolism, responsible for converting leukotriene B4 to the much less active metabolite 12-oxo-leukotriene B4. The BRENDA database lists leukotriene B4 12-hydroxydehydrogenase as one of the synonyms of 2-alkenal reductase (EC 1.3.1.74), while 1.3.1.48 is 15-oxoprostaglandin 13-reductase.
Probab=98.61  E-value=8.9e-08  Score=69.23  Aligned_cols=51  Identities=31%  Similarity=0.558  Sum_probs=44.2

Q ss_pred             eeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhc
Q 039200           10 NKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERM   64 (88)
Q Consensus        10 n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m   64 (88)
                      .|+|+|+++|++.+.++.|++++.++|  .| ++ ||||||+.+.|++|++|..+
T Consensus         1 ~~~~~~~~~~~~~~~~~~l~~~~~~~p--~~-~~-~evlv~v~a~~~n~~~~~g~   51 (325)
T TIGR02825         1 AKTWTLKKHFVGYPTDSDFELKTVELP--PL-NN-GEVLLEALFLSVDPYMRVAA   51 (325)
T ss_pred             CcEEEEecCCCCCCCCCceEEEeccCC--CC-CC-CcEEEEEEEEecCHHHhccc
Confidence            378999999999999999999887775  33 66 89999999999999988654


No 7  
>cd05288 PGDH Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino 
Probab=98.32  E-value=2e-06  Score=61.57  Aligned_cols=54  Identities=35%  Similarity=0.564  Sum_probs=45.2

Q ss_pred             eeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhccC
Q 039200            9 SNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERMSK   66 (88)
Q Consensus         9 ~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~~   66 (88)
                      +||+|+|..+|+|.+.++.+++++.+++  . +++ |+++||+++.+++|..+.++..
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~p--~-~~~-~~v~Vkv~~~~i~~~~~~~~~~   54 (329)
T cd05288           1 SNRQVVLAKRPEGPPPPDDFELVEVPLP--E-LKD-GEVLVRTLYLSVDPYMRGWMSD   54 (329)
T ss_pred             CCcEEEEeccCCCCCCccceeEEeccCC--C-CCC-CeEEEEEEEEecCHHHhhhhcc
Confidence            5899999999988777889999887775  2 366 8999999999999987776654


No 8  
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto- 13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of ac
Probab=97.79  E-value=5.2e-05  Score=54.30  Aligned_cols=49  Identities=33%  Similarity=0.532  Sum_probs=40.5

Q ss_pred             eeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhh
Q 039200           10 NKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRE   62 (88)
Q Consensus        10 n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~   62 (88)
                      -|+|+++++..|.+..+.+++++.++|  .| ++ ||||||+.+.++||++|.
T Consensus         3 ~~~~~~~~~~~~~~~~~~l~~~~~~~p--~~-~~-~evlVkv~a~~in~~~~~   51 (329)
T cd08294           3 AKTWVLKKHFDGKPKESDFELVEEELP--PL-KD-GEVLCEALFLSVDPYMRP   51 (329)
T ss_pred             ceEEEEecCCCCCCCccceEEEecCCC--CC-CC-CcEEEEEEEEecCHHHhc
Confidence            478999997677667788999888876  33 66 899999999999998875


No 9  
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase.
Probab=92.96  E-value=0.3  Score=35.33  Aligned_cols=29  Identities=3%  Similarity=0.202  Sum_probs=23.6

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGP   58 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDP   58 (88)
                      +++++++.++|  .| ++ ||+|||+.+.+++|
T Consensus        11 ~~l~~~e~~~p--~~-~~-~evlVkv~~~gi~~   39 (308)
T TIGR01202        11 NQIELREVTLT--PP-SP-GDLVVEIWYSGIST   39 (308)
T ss_pred             CeEEEEEecCC--CC-CC-CeEEEEEEEEeecc
Confidence            46888887775  33 55 89999999999987


No 10 
>cd08234 threonine_DH_like L-threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine, via NAD(H)-dependent oxidation.  THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs  have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria),  and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Probab=92.95  E-value=0.51  Score=33.76  Aligned_cols=35  Identities=14%  Similarity=0.111  Sum_probs=26.5

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERMS   65 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~   65 (88)
                      .|++.+.++|  . +++ ||++||+++.+++|.......
T Consensus        11 ~~~~~~~~~~--~-l~~-~~v~v~v~~~~l~~~d~~~~~   45 (334)
T cd08234          11 ELEVEEVPVP--E-PGP-DEVLIKVAACGICGTDLHIYE   45 (334)
T ss_pred             ceEEEeccCC--C-CCC-CeEEEEEEEEeEchhhhHHhc
Confidence            5788777765  2 355 899999999999988665543


No 11 
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=91.44  E-value=1.1  Score=31.94  Aligned_cols=43  Identities=12%  Similarity=0.113  Sum_probs=31.8

Q ss_pred             eeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           10 NKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        10 n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      ||.|.+.++.    .+++|++.+.++|  .+ ++ |+++||+.+.++++.-
T Consensus         1 ~~~~~~~~~~----~~~~~~~~~~~~~--~~-~~-~~v~i~v~~~~i~~~d   43 (331)
T cd08273           1 NREVVVTRRG----GPEVLKVVEADLP--EP-AA-GEVVVKVEASGVSFAD   43 (331)
T ss_pred             CeeEEEccCC----CcccEEEeccCCC--CC-CC-CeEEEEEEEEecCHHH
Confidence            5777776443    2467999888775  33 55 8999999999998753


No 12 
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated
Probab=91.30  E-value=0.57  Score=33.86  Aligned_cols=30  Identities=17%  Similarity=0.147  Sum_probs=23.8

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +.|++++.+.|  .+ ++ +|++||+++.++++.
T Consensus        11 ~~~~~~~~~~p--~~-~~-~evlV~v~~~~v~~~   40 (341)
T PRK05396         11 PGLWLTDVPVP--EP-GP-NDVLIKVKKTAICGT   40 (341)
T ss_pred             CceEEEECCCC--CC-CC-CeEEEEEEEEEEccc
Confidence            56888888775  23 55 899999999999774


No 13 
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordin
Probab=91.16  E-value=0.86  Score=32.76  Aligned_cols=49  Identities=14%  Similarity=0.146  Sum_probs=32.6

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERM   64 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m   64 (88)
                      |.+++.+ +.+.+..+.|++.+.+.|  .+ ++ |||+||+.+.++++.-..+.
T Consensus         2 ~a~~~~~-~~~~~~~~~~~~~~~~~p--~~-~~-~evlv~v~~~gi~~~d~~~~   50 (324)
T cd08291           2 KALLLEE-YGKPLEVKELSLPEPEVP--EP-GP-GEVLIKVEAAPINPSDLGFL   50 (324)
T ss_pred             eEEEEee-cCCCccccEEEecccCCC--CC-CC-CeEEEEEEEccCCHHHHHHh
Confidence            4555544 233223467888777665  33 66 89999999999998755544


No 14 
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates.  For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the
Probab=91.14  E-value=0.78  Score=33.77  Aligned_cols=41  Identities=15%  Similarity=-0.024  Sum_probs=30.2

Q ss_pred             eeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200            9 SNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus         9 ~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ++|.+++.+.+      ..+++++.++|  .+ ++ ||||||+.+.++.+.
T Consensus         2 ~~ka~~~~~~~------~~~~l~~~~~p--~~-~~-~evlIkv~a~gi~~~   42 (369)
T cd08301           2 TCKAAVAWEAG------KPLVIEEVEVA--PP-QA-MEVRIKILHTSLCHT   42 (369)
T ss_pred             ccEEEEEecCC------CCcEEEEeeCC--CC-CC-CeEEEEEEEEeeCch
Confidence            46777776543      23788877775  23 66 899999999999886


No 15 
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group contains members identified as zinc dependent alcohol dehydrogenases (ADH), and class III ADG (aka formaldehyde dehydrogenase, FDH). Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  Class III ADH are also know as glutathione-dependent formaldehyde dehyd
Probab=90.07  E-value=1.6  Score=32.27  Aligned_cols=47  Identities=15%  Similarity=0.135  Sum_probs=31.5

Q ss_pred             eEEEEccC--CCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchh
Q 039200           11 KRVILSNY--VTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMR   61 (88)
Q Consensus        11 ~~vvl~~~--P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R   61 (88)
                      |.+++.++  |+++=.++.+++++.++|  .+ ++ +|||||+.+.++.+.=.
T Consensus         2 ka~~~~~~g~~~~~~~~~~l~~~~~~~P--~~-~~-~evlV~v~~~gi~~~D~   50 (371)
T cd08281           2 RAAVLRETGAPTPYADSRPLVIEEVELD--PP-GP-GEVLVKIAAAGLCHSDL   50 (371)
T ss_pred             cceEEEecccccccccCCCceEEEeecC--CC-CC-CeEEEEEEEEeeCccch
Confidence            45555553  222223567899888876  33 55 89999999999988633


No 16 
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates.  For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ i
Probab=89.83  E-value=1.2  Score=32.84  Aligned_cols=41  Identities=15%  Similarity=0.013  Sum_probs=29.8

Q ss_pred             eeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200            9 SNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus         9 ~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ++|.+++.+..      ..+++++.++|  .+ ++ +|++||+.+.++.+.
T Consensus         2 ~~ka~~~~~~~------~~~~~~~~~~p--~~-~~-~evlVkv~~~gi~~s   42 (365)
T cd08277           2 KCKAAVAWEAG------KPLVIEEIEVA--PP-KA-NEVRIKMLATSVCHT   42 (365)
T ss_pred             ccEEEEEccCC------CCcEEEEEECC--CC-CC-CEEEEEEEEEeechh
Confidence            46777776532      23788887775  33 55 899999999999875


No 17 
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases. This group contains proteins identified as sorbitol dehydrogenases and other sugar dehydrogenases of the medium-chain dehydrogenase/reductase family (MDR), which includes zinc-dependent alcohol dehydrogenase and related proteins. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Related proteins include threonine dehydrogenase, formaldehyde dehydrogenase, and butanediol dehydrogenase. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast
Probab=89.56  E-value=1.9  Score=31.04  Aligned_cols=43  Identities=19%  Similarity=0.118  Sum_probs=30.2

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERM   64 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m   64 (88)
                      |.|++.+.       ..+++++.++|  . .++ +|++||+++.+++|.-..+.
T Consensus         2 ~a~~~~~~-------~~l~~~~~~~~--~-l~~-~~v~v~v~~~~~n~~d~~~~   44 (343)
T cd08236           2 KALVLTGP-------GDLRYEDIPKP--E-PGP-GEVLVKVKACGICGSDIPRY   44 (343)
T ss_pred             eeEEEecC-------CceeEEecCCC--C-CCC-CeEEEEEEEEEECccchHhh
Confidence            46777654       23677777765  2 355 89999999999998755443


No 18 
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family. This model represents a subfamily of pfam00107 as defined by Pfam, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc. This subfamily includes proteins studied crystallographically for insight into function: YhdH from Escherichia coli and YhfP from Bacillus subtilis. Members bind NADPH or NAD, but not zinc.
Probab=89.48  E-value=0.99  Score=32.10  Aligned_cols=41  Identities=17%  Similarity=0.215  Sum_probs=29.5

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.+++++ ..|   ++.+++++.++|  .+ ++ ++++||+.+.++++.
T Consensus         1 ~a~~~~~-~~~---~~~~~~~~~~~p--~~-~~-~~v~v~v~~~~i~~~   41 (323)
T TIGR02823         1 KALVVEK-EDG---KVSAQVETLDLS--DL-PE-GDVLIKVAYSSLNYK   41 (323)
T ss_pred             CeEEEcc-CCC---CcceeEeecCCC--CC-CC-CeEEEEEEEEEcCHH
Confidence            4566665 223   257888887775  23 55 899999999999885


No 19 
>cd08230 glucose_DH Glucose dehydrogenase. Glucose dehydrogenase (GlcDH), a member of the medium chain dehydrogenase/zinc-dependent alcohol dehydrogenase-like family, catalyzes the NADP(+)-dependent oxidation of glucose to gluconate, the first step in the Entner-Doudoroff pathway, an alternative to or substitute for glycolysis or the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases  (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossman fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology  to GroES.  The MDR group contai
Probab=89.12  E-value=1.2  Score=32.61  Aligned_cols=35  Identities=14%  Similarity=0.127  Sum_probs=27.3

Q ss_pred             cEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhccC
Q 039200           28 MKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERMSK   66 (88)
Q Consensus        28 f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~~   66 (88)
                      +++++.++|  .+ ++ ||||||+++.++.+.=+.++++
T Consensus        13 l~~~~~p~p--~~-~~-~evlVkv~a~gi~~~D~~~~~g   47 (355)
T cd08230          13 VRVVDIPEP--EP-TP-GEVLVRTLEVGVCGTDREIVAG   47 (355)
T ss_pred             CeEEeCCCC--CC-CC-CeEEEEEEEEEeccccHHHHcC
Confidence            888877765  33 55 8999999999999987766543


No 20 
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]
Probab=89.02  E-value=0.73  Score=34.25  Aligned_cols=31  Identities=16%  Similarity=0.187  Sum_probs=23.7

Q ss_pred             CCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           25 ESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        25 ~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ++++++++.+.|  .| ++ ||||||+.+.|+.|-
T Consensus        12 ~~~l~~~e~~~P--~p-~~-geVlVrV~a~gvN~~   42 (326)
T COG0604          12 PEVLKVVEVPEP--EP-GP-GEVLVRVKAAGVNPI   42 (326)
T ss_pred             CceeEEEecCCC--CC-CC-CeEEEEEEEeecChH
Confidence            344788777775  33 65 899999999999874


No 21 
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase. NAD-linked ribitol-5-phosphate dehydrogenase, a member of the MDR/zinc-dependent alcohol dehydrogenase-like family, oxidizes the phosphate ester of ribitol-5-phosphate to xylulose-5-phosphate of the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (
Probab=88.99  E-value=0.82  Score=33.52  Aligned_cols=31  Identities=19%  Similarity=0.146  Sum_probs=23.6

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchh
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMR   61 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R   61 (88)
                      .++++++.+.|   + ++ ||||||+.+.++-+.=.
T Consensus        12 ~~~~~~~~~~P---~-~~-~eVlVkv~a~gIc~sD~   42 (341)
T cd08237          12 KFFEVTYEEEN---L-RE-DWVIVRPTYLSICHADQ   42 (341)
T ss_pred             ceEEEeecCCC---C-CC-CeEEEEEEEEEEcCccH
Confidence            56888877765   2 55 89999999999866543


No 22 
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.
Probab=88.96  E-value=1.1  Score=32.48  Aligned_cols=38  Identities=11%  Similarity=0.032  Sum_probs=26.9

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+ |      +.+++++.++|  .+ ++ +|||||+++.++.+.
T Consensus         2 ka~~~~~-~------~~l~~~~~~~p--~~-~~-~evlV~v~a~~~~~~   39 (351)
T cd08233           2 KAARYHG-R------KDIRVEEVPEP--PV-KP-GEVKIKVAWCGICGS   39 (351)
T ss_pred             ceEEEec-C------CceEEEeccCC--CC-CC-CeEEEEEEEEEECcc
Confidence            4667643 2      35778777665  33 66 899999999999764


No 23 
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases. Yhdh putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catal
Probab=88.67  E-value=1.3  Score=31.37  Aligned_cols=41  Identities=12%  Similarity=0.083  Sum_probs=29.3

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+ +.+ +  +.+++++.+.|  .+ ++ |+++||+.+.++++.
T Consensus         2 ~a~~~~~-~~~-~--~~~~~~~~~~p--~~-~~-~~v~v~v~~~~i~~~   42 (324)
T cd08288           2 KALVLEK-DDG-G--TSAELRELDES--DL-PE-GDVTVEVHYSTLNYK   42 (324)
T ss_pred             eeEEEec-cCC-C--cceEEEECCCC--CC-CC-CeEEEEEEEEecCHH
Confidence            5677753 333 2  66888887765  23 55 899999999999863


No 24 
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). The gene neighborhood of members of this family is not conserved and it appears that no members are characterized. The sequence of the family includes 6 invariant cysteine residues and one invariant histidine. It appears that no member is characterized.
Probab=88.05  E-value=2.8  Score=30.59  Aligned_cols=37  Identities=8%  Similarity=0.092  Sum_probs=27.3

Q ss_pred             CCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchh
Q 039200           21 GFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMR   61 (88)
Q Consensus        21 g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R   61 (88)
                      |.+..+.+++++.+.|  .+ ++ ||+|||+.+.++.+.-.
T Consensus         8 g~~~~~~l~~~~~p~P--~~-~~-~evlVkv~~~gi~~~D~   44 (329)
T TIGR02822         8 GPIEDGPLRFVERPVP--RP-GP-GELLVRVRACGVCRTDL   44 (329)
T ss_pred             CcCCCCCceEEeCCCC--CC-CC-CeEEEEEEEEeecchhH
Confidence            3344467899877775  33 66 89999999999988643


No 25 
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=87.72  E-value=1.7  Score=30.54  Aligned_cols=40  Identities=5%  Similarity=0.070  Sum_probs=28.9

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+  .+   ++.|++++.++|  .+ ++ +|++||+++.++++.
T Consensus         2 ~~~~~~~--~~---~~~~~~~~~~~p--~~-~~-~ev~v~v~~~~i~~~   41 (305)
T cd08270           2 RALVVDP--DA---PLRLRLGEVPDP--QP-AP-HEALVRVAAISLNRG   41 (305)
T ss_pred             eEEEEcc--CC---CceeEEEecCCC--CC-CC-CEEEEEEEEEecCHH
Confidence            5666644  23   457888877775  23 55 899999999999874


No 26 
>cd05282 ETR_like 2-enoyl thioester reductase-like. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossman
Probab=87.19  E-value=1.8  Score=30.55  Aligned_cols=40  Identities=23%  Similarity=0.217  Sum_probs=29.3

Q ss_pred             CCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhc
Q 039200           21 GFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERM   64 (88)
Q Consensus        21 g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m   64 (88)
                      |.+.+++|++++.+.|  .+ ++ ++++||+.+.+++++-...+
T Consensus         7 ~~~~~~~~~~~~~~~~--~~-~~-~~v~i~v~~~~~~~~d~~~~   46 (323)
T cd05282           7 GEPLPLVLELVSLPIP--PP-GP-GEVLVRMLAAPINPSDLITI   46 (323)
T ss_pred             CCCccceEEeEeCCCC--CC-CC-CeEEEEEEeccCCHHHHHHh
Confidence            4555567888777665  23 56 89999999999999765544


No 27 
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group contains proteins that share the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenase family.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. 
Probab=85.52  E-value=2.6  Score=29.77  Aligned_cols=39  Identities=21%  Similarity=0.126  Sum_probs=26.9

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+ +     .+.+.+.+.+.|  . +++ |+++||+++.+++++
T Consensus         2 ~a~~~~~-~-----~~~~~~~~~~~p--~-~~~-~~v~v~v~~~~i~~~   40 (332)
T cd08259           2 KAAILHK-P-----NKPLQIEEVPDP--E-PGP-GEVLIKVKAAGVCYR   40 (332)
T ss_pred             eEEEEec-C-----CCceEEEEccCC--C-CCC-CeEEEEEEEEecchh
Confidence            4666654 1     235677666654  2 355 899999999999985


No 28 
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein. Members of this model form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases (pfam00107). While some current members of this family carry designations as putative alginate lyase, it seems no sequence with a direct characterization as such is detected by this model.
Probab=85.12  E-value=2.1  Score=30.60  Aligned_cols=31  Identities=13%  Similarity=0.106  Sum_probs=23.8

Q ss_pred             CCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           25 ESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        25 ~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ++.+++++.++|  .+ ++ +||+||+.+.++++.
T Consensus        14 ~~~~~~~~~~~p--~~-~~-~ev~Ikv~~~~i~~~   44 (336)
T TIGR02817        14 PDALVDIDLPKP--KP-GG-RDLLVEVKAISVNPV   44 (336)
T ss_pred             cccceecccCCC--CC-CC-CEEEEEEEEEEcChH
Confidence            466777776665  23 66 899999999999885


No 29 
>PLN02740 Alcohol dehydrogenase-like
Probab=84.24  E-value=4.1  Score=30.27  Aligned_cols=44  Identities=14%  Similarity=0.072  Sum_probs=30.4

Q ss_pred             cceeeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200            6 EAVSNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus         6 ~~~~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ++++.|.+++... .     +.+++++.+.|  .+ ++ |||+||+.+.++.+.
T Consensus         7 ~~~~mka~~~~~~-~-----~~~~~~e~~~P--~~-~~-~eVlV~v~~~gic~s   50 (381)
T PLN02740          7 KVITCKAAVAWGP-G-----EPLVMEEIRVD--PP-QK-MEVRIKILYTSICHT   50 (381)
T ss_pred             cceeeEEEEEecC-C-----CCcEEEEeeCC--CC-CC-CeEEEEEEEEecChh
Confidence            4556777777532 1     23677776665  33 55 899999999999774


No 30 
>TIGR01751 crot-CoA-red crotonyl-CoA reductase. The enzyme modelled by this alignment is responsible for the conversion of crotonyl-CoA reductase to butyryl-CoA. In serine cycle methylotrophic bacteria this enzyme is involved in the process of acetyl-CoA to glyoxylate. In other bacteria the enzyme is used to produce butyrate for incorporation into polyketides such as tylosin from Streptomyces fradiae and coronatine from Pseudomonas syringae.
Probab=84.20  E-value=2.5  Score=31.56  Aligned_cols=45  Identities=11%  Similarity=0.132  Sum_probs=30.4

Q ss_pred             eeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCc
Q 039200            9 SNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGP   58 (88)
Q Consensus         9 ~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDP   58 (88)
                      +.|.|++...-.|.|. +.+++.+.+.|  .+ ++ |+++||+++.++..
T Consensus         7 ~~~a~~~~~~~~~~~~-~~~~~~~~~~p--~l-~~-~evlV~v~~~gi~~   51 (398)
T TIGR01751         7 TMYAFAIREERDGDPR-QAIQLEVVPVP--EL-GP-GEVLVAVMAAGVNY   51 (398)
T ss_pred             hhhheEEecccCCCcc-cceEEeecCCC--CC-CC-CeEEEEEEEEecCc
Confidence            4588888531123222 57888777765  33 55 89999999999973


No 31 
>cd08290 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann f
Probab=84.04  E-value=2.2  Score=30.61  Aligned_cols=43  Identities=23%  Similarity=0.314  Sum_probs=29.5

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+.  |.+. +.+++++.+.|  .+..+ ++++||+.+.++.+.
T Consensus         2 ~a~~~~~~--~~~~-~~~~~~~~~~p--~~~~~-~~v~v~v~~~gi~~~   44 (341)
T cd08290           2 KALVYTEH--GEPK-EVLQLESYEIP--PPGPP-NEVLVKMLAAPINPA   44 (341)
T ss_pred             ceEEEccC--CCch-hheEEeecCCC--CCCCC-CEEEEEEEecCCCHH
Confidence            46677544  3222 67888877775  23344 799999999999875


No 32 
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=83.89  E-value=7.1  Score=27.52  Aligned_cols=45  Identities=20%  Similarity=0.127  Sum_probs=31.1

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhh
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRER   63 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~   63 (88)
                      |.|+++.+  +  ..++|++++.+.+  .+ ++ +|++||+.+.++++.-+..
T Consensus         2 ~a~~~~~~--~--~~~~~~~~~~~~~--~~-~~-~~v~i~v~~~~i~~~d~~~   46 (336)
T cd08276           2 KAWRLSGG--G--GLDNLKLVEEPVP--EP-GP-GEVLVRVHAVSLNYRDLLI   46 (336)
T ss_pred             eEEEEecc--C--CCcceEEEeccCC--CC-CC-CeEEEEEEEEecCHHHHHH
Confidence            57777654  2  2356788766654  23 55 8999999999999864443


No 33 
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dim
Probab=83.82  E-value=4.2  Score=29.99  Aligned_cols=29  Identities=14%  Similarity=0.056  Sum_probs=22.5

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+++++.+.|  .+ ++ ||||||+.+.++.+.
T Consensus        14 ~~~~~~~~~P--~~-~~-~eVlIrv~a~gi~~~   42 (368)
T cd08300          14 PLSIEEVEVA--PP-KA-GEVRIKILATGVCHT   42 (368)
T ss_pred             CcEEEEeecC--CC-CC-CEEEEEEEEEEechh
Confidence            4678777765  33 66 899999999999774


No 34 
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions  near  the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates.  Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.   ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononu
Probab=83.52  E-value=3.5  Score=30.36  Aligned_cols=41  Identities=7%  Similarity=0.047  Sum_probs=28.3

Q ss_pred             eeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200            9 SNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus         9 ~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +.|.+++.+..      ..+++++.++|  .+ ++ +|++||+.+.++.+.
T Consensus         2 ~~~a~~~~~~~------~~~~~~~~~~p--~~-~~-~~v~Vkv~a~gi~~~   42 (365)
T cd08278           2 KTTAAVVREPG------GPFVLEDVELD--DP-RP-DEVLVRIVATGICHT   42 (365)
T ss_pred             ccEEeeeccCC------CcceEEEeecC--CC-CC-CeEEEEEEEeecCcc
Confidence            34677776521      13677777765  23 55 899999999999774


No 35 
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members. Includes Human Mgc45594 gene product of undetermined function. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Probab=83.44  E-value=7.4  Score=27.66  Aligned_cols=43  Identities=16%  Similarity=0.394  Sum_probs=29.5

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+.-.+.  .+-+++++.+.|  .+ ++ ++++||+.+.++++.
T Consensus         3 ~~~~~~~~~~~~--~~~~~~~~~~~~--~~-~~-~ev~i~v~~~gi~~~   45 (329)
T cd08250           3 RKLVVHRLSPNF--REATSIVDVPVP--LP-GP-GEVLVKNRFVGINAS   45 (329)
T ss_pred             eEEEeccCCCCc--ccCceEEecCCC--CC-CC-CEEEEEEEEEecCHH
Confidence            567776632333  344788776654  33 55 899999999999875


No 36 
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like. MDR/AHD-like proteins, including a protein annotated as a threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)-dependent oxidation. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones.  Zinc-dependent ADHs are medium chain dehydrogenase/reductase type proteins (MDRs) and have a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. In addition to alcohol dehydrogenases, this group includes quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others.  These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc at
Probab=83.30  E-value=3.7  Score=29.57  Aligned_cols=30  Identities=17%  Similarity=0.143  Sum_probs=23.3

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..+++++.++|  .+ ++ +||+||+.+.++.+.
T Consensus        10 ~~l~~~~~~~p--~~-~~-~evlV~v~~~gi~~~   39 (339)
T cd08239          10 RTVELREFPVP--VP-GP-GEVLLRVKASGLCGS   39 (339)
T ss_pred             CceEEEecCCC--CC-CC-CeEEEEEEEEEeccc
Confidence            46888777765  33 55 899999999999875


No 37 
>cd08252 AL_MDR Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, whil
Probab=82.71  E-value=3.3  Score=29.53  Aligned_cols=45  Identities=13%  Similarity=0.118  Sum_probs=28.6

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      |.+++.+ +.+.-.++.++.++.+.|  .+ .+ |+++||+++.++++.-
T Consensus         2 ~~~~~~~-~~~~~~~~~~~~~~~~~~--~~-~~-~~v~v~v~~~~i~~~d   46 (336)
T cd08252           2 KAIGFTQ-PLPITDPDSLIDIELPKP--VP-GG-RDLLVRVEAVSVNPVD   46 (336)
T ss_pred             ceEEecC-CCCCCcccceeEccCCCC--CC-CC-CEEEEEEEEEEcCHHH
Confidence            4566665 222223345666555554  22 55 8999999999999864


No 38 
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=82.48  E-value=4.9  Score=29.44  Aligned_cols=40  Identities=13%  Similarity=0.096  Sum_probs=28.1

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      |.+++.+.  |.    .+++++.++|  .+ ++ ||||||+.+.++.+.-
T Consensus         3 ka~~~~~~--~~----~~~~~~~~~p--~~-~~-~evlV~v~~~gi~~~D   42 (358)
T TIGR03451         3 RGVIARSK--GA----PVELETIVVP--DP-GP-GEVIVDIQACGVCHTD   42 (358)
T ss_pred             EEEEEccC--CC----CCEEEEEECC--CC-CC-CeEEEEEEEEeecHHH
Confidence            56666543  21    2688877775  33 66 8999999999998863


No 39 
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase. 6-hydroxyhexanoate dehydrogenase, an enzyme of the zinc-dependent alcohol dehydrogenase-like family of medium chain dehydrogenases/reductases catalyzes the conversion of 6-hydroxyhexanoate and NAD(+) to 6-oxohexanoate + NADH and H+.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.  A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzy
Probab=82.30  E-value=3.7  Score=29.72  Aligned_cols=28  Identities=11%  Similarity=-0.066  Sum_probs=21.4

Q ss_pred             cEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           28 MKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        28 f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +++.+.++|  .+ ++ |||+||+.+.++++.
T Consensus        13 ~~~~~~~~p--~~-~~-~ev~V~v~~~~i~~~   40 (350)
T cd08240          13 LEEVEIDTP--KP-PG-TEVLVKVTACGVCHS   40 (350)
T ss_pred             ceEEecCCC--CC-CC-CeEEEEEEEEecCch
Confidence            677766665  23 55 899999999999874


No 40 
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=82.07  E-value=2.2  Score=29.88  Aligned_cols=33  Identities=18%  Similarity=0.043  Sum_probs=24.7

Q ss_pred             cEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhc
Q 039200           28 MKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERM   64 (88)
Q Consensus        28 f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m   64 (88)
                      |++.+.+++  . .++ ++|+||+++.++++......
T Consensus        14 ~~~~~~~~~--~-~~~-~~v~v~v~~~~i~~~d~~~~   46 (319)
T cd08267          14 LLEVEVPIP--T-PKP-GEVLVKVHAASVNPVDWKLR   46 (319)
T ss_pred             hccccCCCC--C-CCC-CEEEEEEEEeeCCHHHHHHH
Confidence            567666664  2 366 89999999999999765554


No 41 
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i
Probab=82.00  E-value=3.7  Score=29.48  Aligned_cols=29  Identities=17%  Similarity=0.063  Sum_probs=22.7

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .|++++.+.|  . +++ |+|+||+.+.++++.
T Consensus        10 ~~~~~~~~~p--~-~~~-~~v~V~v~~~~~~~~   38 (341)
T cd08262          10 PLVVRDVPDP--E-PGP-GQVLVKVLACGICGS   38 (341)
T ss_pred             ceEEEecCCC--C-CCC-CeEEEEEEEEEEccc
Confidence            5888777765  2 366 899999999999864


No 42 
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 5-dehydrogenase (L-ido 5-DH ) catalyzes the conversion of L-lodonate to 5-ketogluconate in the metabolism of L-Idonate to  6-P-gluconate. In E. coli, this GntII pathway is a subsidiary pathway to the canonical GntI system, which also phosphorylates and transports gluconate.  L-ido 5-DH is found in an operon with a regulator indR, transporter idnT, 5-keto-D-gluconate 5-reductase, and Gnt kinase. L-ido 5-DH is a zinc-dependent alcohol dehydrogenase-like protein. The alcohol dehydrogenase ADH-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH.  This group is also called the medium chain dehydrogenases/reductase family (MDR) which displays a broad range of activities and are distinguished from the smaller short chain dehydrogenases(~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domai
Probab=81.58  E-value=2.9  Score=30.00  Aligned_cols=31  Identities=10%  Similarity=0.064  Sum_probs=24.6

Q ss_pred             CCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           25 ESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        25 ~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+.|++++.++|  . +++ +||+||+.+.++++.
T Consensus         6 ~~~~~~~~~~~p--~-l~~-~~v~I~v~~~~i~~~   36 (339)
T cd08232           6 AGDLRVEERPAP--E-PGP-GEVRVRVAAGGICGS   36 (339)
T ss_pred             CCceEEEEcCCC--C-CCC-CEEEEEEEEEEECcc
Confidence            367888888775  2 366 899999999999875


No 43 
>cd05278 FDH_like Formaldehyde dehydrogenases. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  Formaldehyde dehydrogenase (aka ADH3) may be the ancestral form of alcohol dehydrogenase, which evolved to detoxify formaldehyde.  This CD contains glutathione dependant FDH, glutathione independent FDH, and related alcohol dehydrogenases. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typicall
Probab=81.44  E-value=4.4  Score=29.06  Aligned_cols=31  Identities=6%  Similarity=-0.037  Sum_probs=23.0

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      .+++.+.++|  .+.++ ++++||+.+.++++.-
T Consensus        11 ~~~~~~~~~p--~~~~~-~~v~i~v~~~~i~~~d   41 (347)
T cd05278          11 KIGLEEVPDP--KIQGP-HDAIVRVTATSICGSD   41 (347)
T ss_pred             ceEEEEcCCC--CCCCC-CeEEEEEEEEEechhh
Confidence            4777776664  23144 8999999999999964


No 44 
>PRK09880 L-idonate 5-dehydrogenase; Provisional
Probab=81.22  E-value=4.8  Score=29.33  Aligned_cols=32  Identities=13%  Similarity=0.013  Sum_probs=24.2

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhh
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRE   62 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~   62 (88)
                      .++++++.+.|   + ++ ||||||+.+.++-+.=..
T Consensus        14 ~~~~~~~~~~p---~-~~-~evlVkv~a~gic~sD~~   45 (343)
T PRK09880         14 KDVAVTEQEIE---W-NN-NGTLVQITRGGICGSDLH   45 (343)
T ss_pred             CceEEEecCCC---C-CC-CeEEEEEEEEEECccccH
Confidence            56788777664   2 55 899999999999887443


No 45 
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase. Putative L-iditol 2-dehydrogenase based on annotation of some members in this subgroup.  L-iditol 2-dehydrogenase catalyzes the NAD+-dependent conversion of L-iditol to L-sorbose in fructose and mannose metabolism. This enzyme is related to sorbitol dehydrogenase, alcohol dehydrogenase, and other medium chain dehydrogenase/reductases. The zinc-dependent alcohol dehydrogenase (ADH-Zn)-like family of proteins is a diverse group of proteins related to the first identified member, class I mammalian ADH.  This group is also called the medium chain dehydrogenases/reductase family (MDR) to highlight its broad range of activities and to distinguish from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal GroES-like catalytic domain.  The MDR group contains a host of activities, i
Probab=81.13  E-value=4.8  Score=28.86  Aligned_cols=38  Identities=18%  Similarity=0.205  Sum_probs=26.8

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+ +      ..+++++.+++  . +.+ ++++||.++.++++.
T Consensus         2 ~~~~~~~-~------~~~~~~~~~~~--~-l~~-~~v~i~v~~~~l~~~   39 (343)
T cd08235           2 KAAVLHG-P------NDVRLEEVPVP--E-PGP-GEVLVKVRACGICGT   39 (343)
T ss_pred             eEEEEec-C------CceEEEEccCC--C-CCC-CeEEEEEEEeeeccc
Confidence            5666643 2      23677766664  2 355 899999999999986


No 46 
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=81.04  E-value=5.7  Score=28.31  Aligned_cols=43  Identities=21%  Similarity=0.240  Sum_probs=28.6

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++. . .+.+..+++++++.+.+  .+ ++ +||+||+.+.++++.
T Consensus         2 ~~~~~~-~-~~~~~~~~~~~~~~~~~--~~-~~-~ev~irv~~~~i~~~   44 (329)
T cd08298           2 KAMVLE-K-PGPIEENPLRLTEVPVP--EP-GP-GEVLIKVEACGVCRT   44 (329)
T ss_pred             eEEEEe-c-CCCCCCCCceEEeccCC--CC-CC-CEEEEEEEEEeccHH
Confidence            455552 2 23334567888777665  22 55 899999999999874


No 47 
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases. Yhdh and yhfp-like putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and so
Probab=80.71  E-value=5.5  Score=28.08  Aligned_cols=36  Identities=11%  Similarity=0.014  Sum_probs=27.3

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERMS   65 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~   65 (88)
                      +.+++++.++|  .+ ++ ++++||..+.++++.-..++.
T Consensus        13 ~~~~~~~~~~p--~~-~~-~~v~v~v~~~~i~~~d~~~~~   48 (325)
T cd05280          13 VSLFLRTLPLD--DL-PE-GDVLIRVHYSSLNYKDALAAT   48 (325)
T ss_pred             CcceEEeCCCC--CC-CC-CeEEEEEEEeecChHHHHHhc
Confidence            56888877775  23 55 899999999999987555543


No 48 
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional
Probab=80.44  E-value=4.1  Score=29.01  Aligned_cols=41  Identities=10%  Similarity=0.025  Sum_probs=28.9

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|.+.+..    .+.+|++++.+.+  .+ ++ ||++||+.+.++.+.
T Consensus         3 ~~~~~~~~~----~~~~~~~~~~~~~--~~-~~-~ev~i~v~~~gi~~~   43 (327)
T PRK10754          3 KRIEFHKHG----GPEVLQAVEFTPA--DP-AE-NEVQVENKAIGINYI   43 (327)
T ss_pred             eEEEEeccC----ChhHeEEeeccCC--CC-CC-CEEEEEEEEEEcCHH
Confidence            566664322    3468888887765  23 55 899999999998764


No 49 
>PLN02827 Alcohol dehydrogenase-like
Probab=80.19  E-value=6.4  Score=29.38  Aligned_cols=30  Identities=7%  Similarity=-0.034  Sum_probs=23.3

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +.+++++.++|  .+ ++ ||||||+.+.++.+.
T Consensus        23 ~~~~~~e~~~P--~~-~~-~eVlVkv~~~gic~s   52 (378)
T PLN02827         23 EALVMEEVEVS--PP-QP-LEIRIKVVSTSLCRS   52 (378)
T ss_pred             CCceEEEeecC--CC-CC-CEEEEEEEEEecChh
Confidence            35788887776  33 65 899999999998775


No 50 
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These alcohol dehydrogenases are related to the cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Cinnamyl alcohol dehydrogenases (CAD) reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short cha
Probab=80.17  E-value=5.9  Score=28.44  Aligned_cols=31  Identities=16%  Similarity=0.114  Sum_probs=24.4

Q ss_pred             CCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           25 ESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        25 ~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..++++.+.+++  .+ ++ ++++||+.+.++.+.
T Consensus        11 ~~~~~~~~~~~~--~~-~~-~~v~v~v~~~~i~~~   41 (341)
T cd08297          11 EKPYEVKDVPVP--EP-GP-GEVLVKLEASGVCHT   41 (341)
T ss_pred             CCCceEEEeeCC--CC-CC-CeEEEEEEEeecchh
Confidence            357888877775  23 55 899999999999885


No 51 
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  This group includes alcohol dehydrogenases corresponding to mammalian classes I, II, IV. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.  A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone.  The N-terminal catalytic domain has a distant homology  to GroES.  These proteins typically form dimers (typically
Probab=79.96  E-value=7.6  Score=28.83  Aligned_cols=45  Identities=11%  Similarity=0.031  Sum_probs=29.7

Q ss_pred             ccceeeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200            5 QEAVSNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus         5 ~~~~~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |..+++|..++.+.+.      .+++++.+.|  .+ ++ +||+||+.+.++.+.
T Consensus         3 ~~~~~~~a~~~~~~~~------~~~l~~~p~p--~~-~~-~~vlvkv~~~gi~~~   47 (373)
T cd08299           3 GKVIKCKAAVLWEPKK------PFSIEEIEVA--PP-KA-HEVRIKIVATGICRS   47 (373)
T ss_pred             cccceeEEEEEecCCC------CcEEEEeecC--CC-CC-CEEEEEEEEEEcCcc
Confidence            3445566555543222      3778877775  23 55 899999999999774


No 52 
>PLN02514 cinnamyl-alcohol dehydrogenase
Probab=79.81  E-value=4.9  Score=29.62  Aligned_cols=41  Identities=12%  Similarity=0.158  Sum_probs=26.8

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchh
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMR   61 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R   61 (88)
                      +.|+ ...|.+.     +++++.++|  .+ ++ ||||||+.+.++.+.=.
T Consensus        11 ~~~~-~~~~~~~-----~~~~~~~~p--~~-~~-~eVlVrv~a~gi~~~D~   51 (357)
T PLN02514         11 TGWA-ARDPSGH-----LSPYTYTLR--KT-GP-EDVVIKVIYCGICHTDL   51 (357)
T ss_pred             EEEE-EecCCCC-----ceEEeecCC--CC-CC-CcEEEEEEEeccChHHH
Confidence            5555 4444432     466665654  23 55 89999999999987533


No 53 
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=79.69  E-value=5.6  Score=28.39  Aligned_cols=29  Identities=21%  Similarity=0.162  Sum_probs=22.6

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .|++++.+.|  .+ ++ ||++||+++.++++.
T Consensus        12 ~~~~~~~~~~--~~-~~-~~v~V~v~~~~i~~~   40 (334)
T PRK13771         12 GYRIEEVPDP--KP-GK-DEVVIKVNYAGLCYR   40 (334)
T ss_pred             CcEEEeCCCC--CC-CC-CeEEEEEEEEeechh
Confidence            3788776665  23 56 899999999999985


No 54 
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family, including threonine dehydrogenase. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reducta
Probab=79.13  E-value=10  Score=26.94  Aligned_cols=38  Identities=13%  Similarity=0.133  Sum_probs=27.0

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+ +      ..+++++.++|  .+ ++ +|++||+.+.|+.+.
T Consensus         2 ~a~~~~~-~------~~~~~~~~~~p--~~-~~-~~vlV~v~a~~i~~~   39 (319)
T cd08242           2 KALVLDG-G------LDLRVEDLPKP--EP-PP-GEALVRVLLAGICNT   39 (319)
T ss_pred             eeEEEeC-C------CcEEEEECCCC--CC-CC-CeEEEEEEEEEEccc
Confidence            5667753 1      24788777775  23 55 899999999999874


No 55 
>cd08246 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl-CoA reductase, a member of the medium chain dehydrogenase/reductase family, catalyzes the NADPH-dependent conversion of crotonyl-CoA to butyryl-CoA, a step in (2S)-methylmalonyl-CoA  production for straight-chain fatty acid biosynthesis.  Like enoyl reductase, another enzyme in fatty acid synthesis, crotonyl-CoA reductase is a member of the zinc-dependent alcohol dehydrogenase-like medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossma
Probab=78.33  E-value=5.2  Score=29.66  Aligned_cols=46  Identities=11%  Similarity=0.067  Sum_probs=29.8

Q ss_pred             eeeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCc
Q 039200            8 VSNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGP   58 (88)
Q Consensus         8 ~~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDP   58 (88)
                      .++|.|++...-.|.+ ...+++++.++|  . .++ |||+||+.+.++..
T Consensus        11 ~~~~a~~~~~~~~g~~-~~~~~~~~~~~p--~-l~~-~evlI~v~~~gi~~   56 (393)
T cd08246          11 EKMYAFAIRPERYGDP-AQAIQLEDVPVP--E-LGP-GEVLVAVMAAGVNY   56 (393)
T ss_pred             hhhhheeeecccCCCc-ccceEEeecCCC--C-CCC-CEEEEEEEEEeecc
Confidence            3457776642112432 245788777775  2 355 89999999999974


No 56 
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase. L-sorbose-1-phosphate reductase, a member of the MDR family, catalyzes the NADPH-dependent conversion of l-sorbose 1-phosphate to d-glucitol 6-phosphate in the metabolism of L-sorbose to  (also converts d-fructose 1-phosphate to d-mannitol 6-phosphate).  The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the found
Probab=78.29  E-value=5.1  Score=30.18  Aligned_cols=29  Identities=14%  Similarity=0.145  Sum_probs=22.5

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ++++++.++|  .+ ++ ||||||+.+.++-+.
T Consensus        13 ~l~~~e~p~P--~~-~~-~eVlVkV~a~gic~s   41 (410)
T cd08238          13 DLRLEKFELP--EI-AD-DEILVRVISDSLCFS   41 (410)
T ss_pred             ceEEEecCCC--CC-CC-CeEEEEEEEeccCCC
Confidence            5888877765  33 55 899999999998664


No 57 
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional
Probab=78.11  E-value=4.5  Score=29.35  Aligned_cols=30  Identities=17%  Similarity=0.094  Sum_probs=22.9

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+++++.++|  .+.++ ||+|||+.+.++.+.
T Consensus        11 ~~~~~~~~~P--~~~~~-~evlV~v~~~gi~~~   40 (347)
T PRK10309         11 IVRVAESPIP--EIKHQ-DDVLVKVASSGLCGS   40 (347)
T ss_pred             ceEEEECCCC--CCCCC-CEEEEEEEEEEEchh
Confidence            4788877775  23245 899999999999874


No 58 
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent i
Probab=77.51  E-value=4.4  Score=28.40  Aligned_cols=30  Identities=10%  Similarity=0.056  Sum_probs=23.2

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +.|++++.++|  . +++ +|++||+++.++.+.
T Consensus         5 ~~~~~~~~~~~--~-l~~-~ev~v~v~~~~i~~~   34 (312)
T cd08269           5 GRFEVEEHPRP--T-PGP-GQVLVRVEGCGVCGS   34 (312)
T ss_pred             CeeEEEECCCC--C-CCC-CeEEEEEEEeeeccc
Confidence            56888777665  2 355 899999999999774


No 59 
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family. This group shares the zinc coordination sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous
Probab=77.37  E-value=8.6  Score=27.53  Aligned_cols=32  Identities=13%  Similarity=0.030  Sum_probs=24.7

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchh
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMR   61 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R   61 (88)
                      ..|++++.++|  .+ ++ ++++||+.+.++.+.-.
T Consensus        12 ~~~~~~~~~~p--~~-~~-~~v~V~v~~~~l~~~d~   43 (306)
T cd08258          12 GNVELREVPEP--EP-GP-GEVLIKVAAAGICGSDL   43 (306)
T ss_pred             CceEEeecCCC--CC-CC-CeEEEEEEEEEechhhH
Confidence            55888777775  22 55 89999999999998644


No 60 
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family. This group has the characteristic catalytic and structural zinc-binding sites of the zinc-dependent alcohol dehydrogenases of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, 
Probab=77.08  E-value=4.8  Score=29.18  Aligned_cols=31  Identities=13%  Similarity=0.090  Sum_probs=23.9

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      .++++++.+.|  . +++ |+++||+++.++.+.-
T Consensus        10 ~~~~~~~~~~p--~-~~~-~~v~V~v~a~~i~~~d   40 (350)
T cd08256          10 QDYRLEEVPVP--R-PGP-GEILVKVEACGICAGD   40 (350)
T ss_pred             CceEEEECCCC--C-CCC-CeEEEEEEEEEEcccc
Confidence            35888877665  2 355 8999999999998863


No 61 
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like. This group contains proteins identified as alcohol dehydrogenases and glutathione-dependant formaldehyde dehydrogenases (FDH) of the zinc-dependent/medium chain alcohol dehydrogenase family.  The MDR family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones.  FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=75.68  E-value=5.3  Score=28.73  Aligned_cols=31  Identities=6%  Similarity=0.065  Sum_probs=23.7

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      ++++++.++|  .+.++ +|++||+.+.++.+.-
T Consensus        11 ~~~~~~~~~p--~~~~~-~ev~V~v~~~~i~~~d   41 (345)
T cd08287          11 DIRVEEVPDP--VIEEP-TDAVIRVVATCVCGSD   41 (345)
T ss_pred             ceeEEeCCCC--CCCCC-CeEEEEEeeeeecccc
Confidence            5788777765  33355 8999999999998853


No 62 
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=75.66  E-value=8  Score=26.93  Aligned_cols=42  Identities=17%  Similarity=0.279  Sum_probs=28.1

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      |.|++...  |  ..+.+++++.+.+  . +++ |+++||+.+.++++.-
T Consensus         2 ~a~~~~~~--~--~~~~~~~~~~~~~--~-~~~-~~v~v~v~~~~i~~~d   43 (326)
T cd08272           2 KALVLESF--G--GPEVFELREVPRP--Q-PGP-GQVLVRVHASGVNPLD   43 (326)
T ss_pred             eEEEEccC--C--CchheEEeecCCC--C-CCC-CeEEEEEEEEecCHHH
Confidence            46666432  2  2345777766664  2 355 8999999999999863


No 63 
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH). This group contains the hypothetical TM0436 alcohol dehydrogenase from Thermotoga maritima,  proteins annotated as 5-exo-alcohol dehydrogenase, and other members of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family.  MDR, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quino
Probab=75.48  E-value=9.8  Score=27.68  Aligned_cols=31  Identities=10%  Similarity=0.014  Sum_probs=23.9

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      +.+++++.++|  .+ ++ +|++||+.+.++.+.=
T Consensus        11 ~~l~~~~~~~p--~~-~~-~evlV~v~a~~l~~~d   41 (361)
T cd08231          11 KPLEIREVPLP--DL-EP-GAVLVRVRLAGVCGSD   41 (361)
T ss_pred             CCCEEEeccCC--CC-CC-CeEEEEEEEEeecCcc
Confidence            46888877775  33 55 8999999999998753


No 64 
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding
Probab=75.25  E-value=20  Score=24.68  Aligned_cols=41  Identities=10%  Similarity=0.115  Sum_probs=27.0

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+..    ....+++++.+.+  . ..+ |+++||+++.++++.
T Consensus         2 ~~~~~~~~~----~~~~~~~~~~~~~--~-~~~-~~v~v~v~~~~i~~~   42 (323)
T cd05276           2 KAIVIKEPG----GPEVLELGEVPKP--A-PGP-GEVLIRVAAAGVNRA   42 (323)
T ss_pred             eEEEEecCC----CcccceEEecCCC--C-CCC-CEEEEEEEEeecCHH
Confidence            456665432    2355677665554  2 355 899999999999875


No 65 
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=74.99  E-value=9.4  Score=26.70  Aligned_cols=35  Identities=17%  Similarity=0.156  Sum_probs=26.2

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERM   64 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m   64 (88)
                      ++|++.+.+.|  .+ ++ ++++||+++.++++.-....
T Consensus        13 ~~~~~~~~~~~--~~-~~-~~v~v~v~~~~i~~~d~~~~   47 (325)
T cd08271          13 LQLTLEEIEIP--GP-GA-GEVLVKVHAAGLNPVDWKVI   47 (325)
T ss_pred             ceeEEeccCCC--CC-CC-CEEEEEEEEEecCHHHHHHh
Confidence            47888777665  22 55 89999999999998655443


No 66 
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like. This group is related to formaldehyde dehydrogenase (FDH), which  is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  This family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Another member is identified as a dihydroxyacetone reductase. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins). The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (
Probab=74.77  E-value=9.4  Score=27.49  Aligned_cols=32  Identities=6%  Similarity=-0.059  Sum_probs=23.7

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcchh
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMR   61 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R   61 (88)
                      ++++++.++|  .+.++ +||+||+.+.++.+.-+
T Consensus        11 ~~~~~~~~~p--~~~~~-~ev~v~v~a~~i~~~d~   42 (345)
T cd08286          11 KISWEDRPKP--TIQEP-TDAIVKMLKTTICGTDL   42 (345)
T ss_pred             ceeEEecCCC--CCCCC-CeEEEEEEEeeecchhh
Confidence            4788777665  23355 89999999999987643


No 67 
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide.   A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone.  The N-terminal catalytic domain has a distant homology to GroES.  These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subu
Probab=74.56  E-value=11  Score=27.51  Aligned_cols=39  Identities=10%  Similarity=0.096  Sum_probs=27.3

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+.  |    ..+++.+.+++  .+ ++ +||+||+.+.++.+.
T Consensus         2 ~a~~~~~~--~----~~~~~~~~~~~--~~-~~-~~v~v~v~~~~l~~~   40 (367)
T cd08263           2 KAAVLKGP--N----PPLTIEEIPVP--RP-KE-GEILIRVAACGVCHS   40 (367)
T ss_pred             eeEEEecC--C----CCcEEEEeeCC--CC-CC-CeEEEEEEEeeeCcc
Confidence            46777543  2    23677777665  23 55 899999999999884


No 68 
>PRK10083 putative oxidoreductase; Provisional
Probab=73.74  E-value=11  Score=27.07  Aligned_cols=30  Identities=13%  Similarity=0.065  Sum_probs=22.6

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..+++++.+.|  .+ ++ +|++||+.+.++.+.
T Consensus        10 ~~~~~~~~~~p--~~-~~-~~vlV~v~~~gi~~~   39 (339)
T PRK10083         10 NSLAIEERPIP--QP-AA-GEVRVKVKLAGICGS   39 (339)
T ss_pred             CeeEEEeccCC--CC-CC-CeEEEEEEEEEEccc
Confidence            35788777665  33 55 899999999999764


No 69 
>PTZ00354 alcohol dehydrogenase; Provisional
Probab=73.37  E-value=12  Score=26.47  Aligned_cols=41  Identities=17%  Similarity=0.138  Sum_probs=27.3

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.+++.+...    ...+++++.+.+  . ..+ |+++||+.+.++++.
T Consensus         3 ~a~~~~~~~~----~~~~~~~~~~~~--~-~~~-~~v~v~v~~~~i~~~   43 (334)
T PTZ00354          3 RAVTLKGFGG----VDVLKIGESPKP--A-PKR-NDVLIKVSAAGVNRA   43 (334)
T ss_pred             EEEEEEecCC----CcceEEEeCCCC--C-CCC-CEEEEEEEEEecCHH
Confidence            5666654321    245777665554  2 355 899999999999875


No 70 
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases. yhfp putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone  + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH
Probab=73.34  E-value=11  Score=26.66  Aligned_cols=41  Identities=10%  Similarity=0.133  Sum_probs=27.8

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+.  |.  .+-+++++.++|  .+ ++ +|++||+.+.++++.
T Consensus         2 ~a~~~~~~--~~--~~~~~~~~~~~p--~~-~~-~ev~i~v~~~~i~~~   42 (326)
T cd08289           2 QALVVEKD--ED--DVSVSVKNLTLD--DL-PE-GDVLIRVAYSSVNYK   42 (326)
T ss_pred             eeEEEecc--CC--cceeEEEEccCC--CC-CC-CeEEEEEEEEecChH
Confidence            45666542  22  246778777665  23 55 899999999999863


No 71 
>PF08240 ADH_N:  Alcohol dehydrogenase GroES-like domain;  InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1.1.1.1 from EC). Many of them contain an inserted zinc binding domain. This domain has a GroES-like structure; a name derived from the superfamily of proteins with a GroES fold. Proteins with a GroES fold structure have a highly conserved hydrophobic core and a glycyl-aspartate dipeptide which is thought to maintain the fold [, ].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1YKF_D 2NVB_A 3FSR_D 1BXZ_B 3FTN_A 3MEQ_D 3UOG_B 3HZZ_B 4DVJ_A 1P0F_A ....
Probab=73.32  E-value=6.7  Score=23.96  Aligned_cols=23  Identities=13%  Similarity=-0.171  Sum_probs=17.9

Q ss_pred             CCeEEEEeEEEeeCcchhhhccC
Q 039200           44 KDTVLLKNLYLSCGPYMRERMSK   66 (88)
Q Consensus        44 ~gevLvr~l~lSvDPy~R~~m~~   66 (88)
                      +||||||+++.++.+.=....+.
T Consensus         1 P~eVlVkv~a~gic~~D~~~~~g   23 (109)
T PF08240_consen    1 PGEVLVKVRAAGICGSDLHIREG   23 (109)
T ss_dssp             TTEEEEEEEEEEE-HHHHHHHTT
T ss_pred             CCEEEEEEEEeeeCHHHHHHHhh
Confidence            38999999999999877666554


No 72 
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. T
Probab=72.61  E-value=11  Score=28.07  Aligned_cols=31  Identities=3%  Similarity=0.012  Sum_probs=23.0

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .++++.+.+.|  .+.++ ++++||+++.++.+.
T Consensus        10 ~~~~~~~~~~p--~~~~~-~~v~i~v~~~~i~~~   40 (386)
T cd08283          10 GDVRVEEVPDP--KIEDP-TDAIVRVTATAICGS   40 (386)
T ss_pred             CCceEEeCCCC--CCCCC-CeEEEEEEEEecchh
Confidence            46788776664  23235 899999999999875


No 73 
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=72.43  E-value=6.3  Score=28.79  Aligned_cols=28  Identities=21%  Similarity=0.056  Sum_probs=21.9

Q ss_pred             cEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           28 MKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        28 f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +++++.+.|  .+ ++ ||++||+.+.++.+.
T Consensus        11 ~~~~~~p~P--~~-~~-~evlVrv~~~gic~s   38 (349)
T TIGR03201        11 MVKTRVEIP--EL-GA-GDVVVKVAGCGVCHT   38 (349)
T ss_pred             ceEEeccCC--CC-CC-CeEEEEEEEEeeccc
Confidence            788777665  33 66 899999999999764


No 74 
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1. Human Reticulon 4 Interacting Protein 1 is a member of the medium chain dehydrogenase/ reductase (MDR) family. Riticulons are endoplasmic reticulum associated proteins involved in membrane trafficking  and neuroendocrine secretion. The MDR/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.
Probab=71.50  E-value=5.3  Score=28.68  Aligned_cols=34  Identities=21%  Similarity=0.136  Sum_probs=24.8

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhh
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRER   63 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~   63 (88)
                      .+++++.++|  .|.++ |||+||+++.+++++-...
T Consensus        15 ~~~~~~~~~p--~~~~~-~ev~v~v~~~~i~~~d~~~   48 (350)
T cd08248          15 LLLLENARIP--VIRKP-NQVLIKVHAASVNPIDVLM   48 (350)
T ss_pred             eeeecccCCC--CCCCC-CeEEEEEEEEecCchhHHH
Confidence            4677776664  33235 8999999999999875543


No 75 
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic
Probab=71.48  E-value=7.5  Score=28.06  Aligned_cols=30  Identities=17%  Similarity=0.098  Sum_probs=23.6

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +.|++++.++|  .+ ++ ||++||+++.++.+.
T Consensus        10 ~~~~~~~~~~p--~~-~~-~evlirv~a~~i~~~   39 (337)
T cd05283          10 GKLEPFTFERR--PL-GP-DDVDIKITYCGVCHS   39 (337)
T ss_pred             CCceEEeccCC--CC-CC-CeEEEEEEEecccch
Confidence            56788888776  23 55 899999999999874


No 76 
>cd08249 enoyl_reductase_like enoyl_reductase_like. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in  Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol de
Probab=71.22  E-value=5  Score=29.09  Aligned_cols=32  Identities=19%  Similarity=0.224  Sum_probs=24.9

Q ss_pred             CCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           25 ESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        25 ~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      ..+|++++.+.|  .+ ++ +|+++|+.+.++++.-
T Consensus        11 ~~~~~~~~~~~p--~~-~~-~ev~i~v~~~~i~~~d   42 (339)
T cd08249          11 GGLLVVVDVPVP--KP-GP-DEVLVKVKAVALNPVD   42 (339)
T ss_pred             CCcccccCCCCC--CC-CC-CEEEEEEEEEEcCchh
Confidence            466888777665  33 66 8999999999999854


No 77 
>cd05281 TDH Threonine dehydrogenase. L-threonine dehydrogenase (TDH) catalyzes the zinc-dependent formation of 2-amino-3-ketobutyrate from L-threonine via NAD(H)- dependent oxidation.  THD is a member of the zinc-requiring, medium chain NAD(H)-dependent alcohol dehydrogenase family (MDR). MDRs  have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria) and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose.
Probab=70.99  E-value=7.9  Score=27.95  Aligned_cols=29  Identities=21%  Similarity=0.188  Sum_probs=22.6

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .|++.+.+.|  .+ ++ +|++||+++.+++|.
T Consensus        12 ~~~~~~~~~~--~~-~~-~~v~V~v~~~~~~~~   40 (341)
T cd05281          12 GAELVEVPVP--KP-GP-GEVLIKVLAASICGT   40 (341)
T ss_pred             ceEEEeCCCC--CC-CC-CeEEEEEEEEEEccc
Confidence            5788777665  33 55 899999999999875


No 78 
>cd05284 arabinose_DH_like D-arabinose dehydrogenase. This group contains arabinose dehydrogenase (AraDH) and related alcohol dehydrogenases. AraDH is a member of the medium chain dehydrogenase/reductase family and catalyzes the NAD(P)-dependent oxidation of D-arabinose and other pentoses, the initial step in the metabolism of d-arabinose into 2-oxoglutarate. Like the alcohol dehydrogenases, AraDH binds a zinc in the catalytic cleft as well as a distal structural zinc. AraDH forms homotetramers as a dimer of dimers. AraDH replaces a conserved catalytic His with replace with Arg, compared to the canonical ADH site. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol d
Probab=70.98  E-value=7.8  Score=27.73  Aligned_cols=29  Identities=10%  Similarity=0.101  Sum_probs=22.2

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .|++++.+.+  .+ ++ |+++||..+.++++.
T Consensus        12 ~~~~~~~~~~--~~-~~-~~v~v~v~~~~i~~~   40 (340)
T cd05284          12 PLRLEDVPVP--EP-GP-GQVLVRVGGAGVCHS   40 (340)
T ss_pred             CceEEeCCCC--CC-CC-CeEEEEEEEEeecch
Confidence            4777766664  23 55 899999999999985


No 79 
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2. Glutathione-dependent formaldehyde dehydrogenases (FDHs) are members of the zinc-dependent/medium chain alcohol dehydrogenase family. Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione.   These tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typical
Probab=69.90  E-value=14  Score=26.39  Aligned_cols=30  Identities=10%  Similarity=0.083  Sum_probs=22.8

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+++++.++|  .+.++ +||+||+.+.++++.
T Consensus        11 ~~~~~~~~~p--~~~~~-~~v~i~v~~~~i~~~   40 (344)
T cd08284          11 DVRVEEVPIP--QIQDP-TDAIVKVTAAAICGS   40 (344)
T ss_pred             CceEEeccCC--CCCCC-CeEEEEEEEeecccc
Confidence            5788777775  23235 899999999999874


No 80 
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=68.90  E-value=33  Score=24.02  Aligned_cols=30  Identities=10%  Similarity=0.046  Sum_probs=22.8

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+|++++.+.+  .+ ++ ++++||+++.++++.
T Consensus        12 ~~~~~~~~~~~--~~-~~-~~v~i~v~~~~i~~~   41 (337)
T cd08275          12 DKLKVEKEALP--EP-SS-GEVRVRVEACGLNFA   41 (337)
T ss_pred             cceEEEecCCC--CC-CC-CEEEEEEEEEecCHH
Confidence            56888776664  23 55 899999999999765


No 81 
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=68.51  E-value=17  Score=25.34  Aligned_cols=30  Identities=13%  Similarity=0.042  Sum_probs=22.0

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..|++.+.+.+  . .++ +|++||+++.++++.
T Consensus        13 ~~~~~~~~~~~--~-~~~-~~v~v~v~~~~i~~~   42 (320)
T cd08243          13 EVLKLREIPIP--E-PKP-GWVLIRVKAFGLNRS   42 (320)
T ss_pred             cceEEeecCCC--C-CCC-CEEEEEEEEEecCHH
Confidence            46677655553  2 355 899999999999874


No 82 
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family. This group contains members identified as related to zinc-dependent alcohol dehydrogenase and other members of the MDR family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group includes various activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase,
Probab=68.23  E-value=16  Score=26.14  Aligned_cols=39  Identities=13%  Similarity=0.133  Sum_probs=26.5

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      |.|++.+ +      ..+++.+.+++  .+ ++ +|++||+.+.++.|.-
T Consensus         2 ~a~~~~~-~------~~~~~~~~~~~--~~-~~-~~v~v~v~~~~l~~~d   40 (337)
T cd08261           2 KALVCEK-P------GRLEVVDIPEP--VP-GA-GEVLVRVKRVGICGSD   40 (337)
T ss_pred             eEEEEeC-C------CceEEEECCCC--CC-CC-CeEEEEEEEEeEcccC
Confidence            5666643 2      24666666654  33 55 8999999999998853


No 83 
>cd05285 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit. Aldose reductase catalyzes the NADP(H)-dependent conversion of glucose to sorbital, and SDH uses NAD(H) in the conversion of sorbitol to fructose.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=68.07  E-value=11  Score=27.29  Aligned_cols=30  Identities=17%  Similarity=0.253  Sum_probs=22.8

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +.|++++.+.+  .+ ++ +|++||+.+.++.|.
T Consensus         8 ~~~~~~~~~~~--~l-~~-~~vlV~v~~~~l~~~   37 (343)
T cd05285           8 GDLRLEERPIP--EP-GP-GEVLVRVRAVGICGS   37 (343)
T ss_pred             CceeEEECCCC--CC-CC-CeEEEEEEEeeEccc
Confidence            45777766664  23 55 899999999999885


No 84 
>TIGR00692 tdh L-threonine 3-dehydrogenase. E. coli His-90 modulates substrate specificity and is believed part of the active site.
Probab=67.78  E-value=9.2  Score=27.57  Aligned_cols=28  Identities=25%  Similarity=0.220  Sum_probs=21.4

Q ss_pred             cEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           28 MKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        28 f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +++++.++|  .+ ++ +|++||+.+.++.+.
T Consensus        11 ~~l~~~~~p--~~-~~-~ev~V~v~~~~~~~~   38 (340)
T TIGR00692        11 AELTEVPVP--EP-GP-GEVLIKVLATSICGT   38 (340)
T ss_pred             cEEEECCCC--CC-CC-CeEEEEEEEEEEccc
Confidence            677766665  33 55 899999999999764


No 85 
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordina
Probab=67.64  E-value=24  Score=24.85  Aligned_cols=42  Identities=14%  Similarity=0.211  Sum_probs=27.7

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.+++.+ + +.| .+.+++.+.+.|  .+ ++ +|++||+.+.++++.
T Consensus         2 ~a~~~~~-~-~~~-~~~~~~~~~~~p--~~-~~-~~v~i~v~~~~~~~~   43 (324)
T cd08292           2 RAAVHTQ-F-GDP-ADVLEIGEVPKP--TP-GA-GEVLVRTTLSPIHNH   43 (324)
T ss_pred             eeEEEcc-C-CCh-hHeEEEeecCCC--CC-CC-CeEEEEEEEccCCHH
Confidence            4566643 2 211 244778777665  23 55 899999999999875


No 86 
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional
Probab=67.55  E-value=11  Score=26.86  Aligned_cols=26  Identities=12%  Similarity=0.104  Sum_probs=20.2

Q ss_pred             EEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           30 ITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        30 l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +++.++|  . .++ ||++||.++.++.+.
T Consensus        15 ~~~~~~p--~-~~~-~evlv~v~~~~i~~~   40 (338)
T PRK09422         15 VVEKTLR--P-LKH-GEALVKMEYCGVCHT   40 (338)
T ss_pred             EEEecCC--C-CCC-CeEEEEEEEEeechh
Confidence            6666665  2 366 899999999999885


No 87 
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts et
Probab=67.46  E-value=15  Score=25.31  Aligned_cols=35  Identities=14%  Similarity=0.094  Sum_probs=24.7

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERM   64 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m   64 (88)
                      +.+++++.+.+  . +++ |+++||..+.++++.-+...
T Consensus        13 ~~~~~~~~~~~--~-~~~-~~v~v~v~~~~i~~~d~~~~   47 (309)
T cd05289          13 EVLELADVPTP--E-PGP-GEVLVKVHAAGVNPVDLKIR   47 (309)
T ss_pred             cceeecccCCC--C-CCC-CeEEEEEEEeeCCHHHHHHh
Confidence            34566555553  2 356 89999999999998866554


No 88 
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=66.36  E-value=19  Score=27.47  Aligned_cols=25  Identities=20%  Similarity=0.244  Sum_probs=19.7

Q ss_pred             cEEEEeecccccCCCCCCeEEEEeEEEee
Q 039200           28 MKITSGSIKLKVADGSKDTVLLKNLYLSC   56 (88)
Q Consensus        28 f~l~~~~~~~~~~~~~~gevLvr~l~lSv   56 (88)
                      +++.+.+.|  .| ++ ||||||+.|.-+
T Consensus        16 l~i~e~~~p--~p-~~-~eVlI~v~~~GV   40 (339)
T COG1064          16 LEIEEVPVP--EP-GP-GEVLIKVEACGV   40 (339)
T ss_pred             ceEEeccCC--CC-CC-CeEEEEEEEEee
Confidence            677777775  33 66 899999999986


No 89 
>PLN02702 L-idonate 5-dehydrogenase
Probab=65.43  E-value=22  Score=25.99  Aligned_cols=30  Identities=13%  Similarity=0.087  Sum_probs=22.1

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..+++++.+.|  .+ ++ +|++||+.+.++.+.
T Consensus        27 ~~l~~~~~~~p--~~-~~-~ev~Ikv~~~~i~~~   56 (364)
T PLN02702         27 NTLKIQPFKLP--PL-GP-HDVRVRMKAVGICGS   56 (364)
T ss_pred             CceEEEeccCC--CC-CC-CeEEEEEEEEEEchh
Confidence            45677666654  23 55 899999999999874


No 90 
>cd08244 MDR_enoyl_red Possible enoyl reductase. Member identified as possible enoyl reductase of the MDR family. 2-enoyl thioester reductase (ETR) catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  ADH is a member of the medium chain alcohol dehydr
Probab=64.99  E-value=20  Score=25.14  Aligned_cols=41  Identities=12%  Similarity=0.063  Sum_probs=26.9

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+.  +  ....|++.+.+.+  . .++ ++++||+.+.++++.
T Consensus         2 ~a~~~~~~--~--~~~~~~~~~~~~~--~-~~~-~~v~v~v~~~~i~~~   42 (324)
T cd08244           2 RAIRLHEF--G--PPEVLVPEDVPDP--V-PGP-GQVRIAVAAAGVHFV   42 (324)
T ss_pred             eEEEEcCC--C--CccceEEeccCCC--C-CCC-CEEEEEEEEEeCCHH
Confidence            45666332  2  2356777665554  2 255 899999999999885


No 91 
>PLN02586 probable cinnamyl alcohol dehydrogenase
Probab=64.98  E-value=19  Score=26.62  Aligned_cols=43  Identities=14%  Similarity=-0.014  Sum_probs=26.4

Q ss_pred             ceeeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200            7 AVSNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus         7 ~~~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +++.++|.+.+.+      +.+++.+.+.|  .+ ++ ||||||+.+.++.+.
T Consensus        10 ~~~~~~~~~~~~~------~~l~~~~~~~p--~~-~~-~eVlV~v~~~gic~s   52 (360)
T PLN02586         10 PQKAFGWAARDPS------GVLSPFHFSRR--EN-GD-EDVTVKILYCGVCHS   52 (360)
T ss_pred             hhheeEEEecCCC------CCceEEeecCC--CC-CC-CeEEEEEEEecCChh
Confidence            4455555553332      33455544443  23 55 899999999999764


No 92 
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH). Formaldehyde dehydrogenase (FDH) is a member of the zinc-dependent/medium chain alcohol dehydrogenase family.  Unlike typical FDH, Pseudomonas putida aldehyde-dismutating FDH (PFDH) is glutathione-independent.  PFDH converts 2 molecules of aldehydes to corresponding carboxylic acid and alcohol.  MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like the zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these tetrameric FDHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains and a structural zinc in a lobe of the catalytic domain. Unlike ADH, where NAD(P)(H) acts as a cofactor, NADH in FDH is a tightly bound redox cofactor (similar to nicotinamide proteins).  The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fo
Probab=63.05  E-value=15  Score=27.19  Aligned_cols=30  Identities=0%  Similarity=-0.070  Sum_probs=22.9

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+++++.++|  .+.++ +|++||+.+.++.+.
T Consensus        11 ~~~~~~~~~p--~~~~~-~evlv~v~a~~i~~~   40 (375)
T cd08282          11 NVAVEDVPDP--KIEHP-TDAIVRITTTAICGS   40 (375)
T ss_pred             ceeEEeCCCC--CCCCC-CeEEEEEEEEeeCHH
Confidence            5788777775  22245 799999999999875


No 93 
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. This group is predominated by atypical alcohol dehydrogenases; they exist as tetramers and exhibit specificity for NADP(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones.  Like other zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), tetrameric ADHs have a catalytic zinc that resides between the catalytic and NAD(H)binding domains; however, they do not have and a structural zinc in a lobe of the catalytic domain.  The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.
Probab=62.83  E-value=15  Score=26.53  Aligned_cols=29  Identities=10%  Similarity=0.158  Sum_probs=21.9

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ++++++.++|  .+ .+ ||++||+.+.++.+.
T Consensus        11 ~~~l~~~~~p--~~-~~-~evlIkv~a~~i~~~   39 (351)
T cd08285          11 KVGWIEKPIP--VC-GP-NDAIVRPTAVAPCTS   39 (351)
T ss_pred             ccEEEECCCC--CC-CC-CeEEEEEEEEEechh
Confidence            3567666664  23 55 899999999999885


No 94 
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation.  There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by  liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall 
Probab=62.83  E-value=25  Score=25.87  Aligned_cols=29  Identities=10%  Similarity=0.024  Sum_probs=22.3

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+++++.++|  .+ ++ ++++||+...++.+.
T Consensus        12 ~~~~~~~~~p--~~-~~-~~vlv~v~~~~i~~~   40 (365)
T cd05279          12 PLSIEEIEVA--PP-KA-GEVRIKVVATGVCHT   40 (365)
T ss_pred             CcEEEEeecC--CC-CC-CeEEEEEEEeeecch
Confidence            3778777775  33 55 899999999999874


No 95 
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent. Members of this family represent a distinct clade within the larger family of zinc-dependent dehydrogenases of medium chain alcohols, a family that also includes the so-called glutathione-dependent formaldehyde dehydrogenase. Members of this protein family have a tightly bound NAD that can act as a true cofactor, rather than a cosubstrate in dehydrogenase reactions, in dismutase reactions for some aldehydes. The name given to this family, however, is formaldehyde dehydrogenase, glutathione-independent.
Probab=62.79  E-value=22  Score=26.84  Aligned_cols=39  Identities=8%  Similarity=-0.047  Sum_probs=26.8

Q ss_pred             CCcEEEEeecccccCC----CCCCeEEEEeEEEeeCcchhhhcc
Q 039200           26 SDMKITSGSIKLKVAD----GSKDTVLLKNLYLSCGPYMRERMS   65 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~----~~~gevLvr~l~lSvDPy~R~~m~   65 (88)
                      .++++++.++|.+.+.    ++ ||||||+.+.++.+.=....+
T Consensus        12 ~~~~~~e~~~P~~~~~~~~~~~-~eVlVkv~a~gIcgsD~~~~~   54 (393)
T TIGR02819        12 GKVEVQDIDYPKLELPDGRKCE-HGVILKVVTTNICGSDQHMVR   54 (393)
T ss_pred             CceeEEeccCCcccCCCccCCC-CeEEEEEEEeeecHHHHHHHC
Confidence            3588888777632100    14 799999999999988555443


No 96 
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. This group has the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (ty
Probab=62.25  E-value=25  Score=25.30  Aligned_cols=39  Identities=10%  Similarity=0.026  Sum_probs=26.1

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      |.|++.+  .|.    .+++++.+.|  .+ .+ ++++||+.+.++++.
T Consensus         2 ~a~~~~~--~~~----~~~~~~~~~~--~~-~~-~~v~v~v~~~~i~~~   40 (345)
T cd08260           2 RAAVYEE--FGE----PLEIREVPDP--EP-PP-DGVVVEVEACGVCRS   40 (345)
T ss_pred             eeEEEec--CCC----CcEEEEccCC--CC-CC-CeEEEEEEEeeccHH
Confidence            5677642  221    2677666654  23 55 899999999999974


No 97 
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast. This group contains members identified in targeting of yeast membrane proteins ATPase. AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast, identified as a multicopy suppressor of pma1 mutants which cause temperature sensitive growth arrest due to the inability of ATPase to target to the cell surface. This family is homologous to the medium chain family of dehydrogenases and reductases. Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-termi
Probab=61.74  E-value=14  Score=26.78  Aligned_cols=33  Identities=15%  Similarity=0.115  Sum_probs=22.0

Q ss_pred             EEEEeecccccCCCCCCeEEEEeEEEeeCcchhh
Q 039200           29 KITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRE   62 (88)
Q Consensus        29 ~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~   62 (88)
                      ++++.+++.+.++++ ++++||.++.++++.-..
T Consensus        14 ~~~~~~~~~p~~~~~-~~v~I~v~~~~~~~~d~~   46 (352)
T cd08247          14 TITTIKLPLPNCYKD-NEIVVKVHAAALNPVDLK   46 (352)
T ss_pred             eeeccCCCCCCCCCC-CeEEEEEEEEecChHhHH
Confidence            455555543221366 899999999999886443


No 98 
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenases of the medium chain dehydrogenase family. However, this subgroup does not contain the characteristic catalytic zinc site. Also, it contains an atypical structural zinc-binding pattern: DxxCxxCxxxxxxxC. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the clo
Probab=60.31  E-value=17  Score=25.80  Aligned_cols=30  Identities=17%  Similarity=0.276  Sum_probs=22.5

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +.|++++.+.+   ++++ +|++||+++.++++.
T Consensus        12 ~~~~~~~~~~~---~~~~-~ev~v~v~~~~i~~~   41 (325)
T cd08264          12 ENLKVEDVKDP---KPGP-GEVLIRVKMAGVNPV   41 (325)
T ss_pred             CceEEEeccCC---CCCC-CeEEEEEEEEEechH
Confidence            55777666554   2366 899999999999874


No 99 
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase. The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated alcohol dehydrogenase (EC 1.1.1.1) of class III, for activities that do not require glutathione; they tend to show poor activity for ethanol among their various substrate alcohols.
Probab=59.10  E-value=17  Score=26.84  Aligned_cols=29  Identities=14%  Similarity=0.171  Sum_probs=21.9

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+++++.+.|  .+ ++ ||||||+.+.++.+.
T Consensus        13 ~l~~~~~~~P--~~-~~-~eVlI~v~a~gi~~s   41 (368)
T TIGR02818        13 PLKIEEVDVE--MP-QK-GEVLVRIVATGVCHT   41 (368)
T ss_pred             CeEEEEecCC--CC-CC-CeEEEEEEEecccHH
Confidence            4677766665  33 55 899999999998775


No 100
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family. This group resembles the zinc-dependent alcohol dehydrogenase and has the catalytic and structural zinc-binding sites characteristic of this group. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology  to GroES.  The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanedi
Probab=57.38  E-value=20  Score=26.62  Aligned_cols=29  Identities=7%  Similarity=0.119  Sum_probs=22.6

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +|++++.+.|  .+ ++ ++++||..+.++.+.
T Consensus        38 ~~~~~~~~~p--~~-~~-~ev~V~v~a~gi~~~   66 (384)
T cd08265          38 ELRVEDVPVP--NL-KP-DEILIRVKACGICGS   66 (384)
T ss_pred             CEEEEECCCC--CC-CC-CEEEEEEEEEEEcHh
Confidence            4888777775  23 55 899999999999763


No 101
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins. Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an 
Probab=56.62  E-value=19  Score=25.56  Aligned_cols=29  Identities=14%  Similarity=0.063  Sum_probs=22.8

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+++++.+.|  .+ .+ ++++||+.+.++++.
T Consensus        11 ~~~~~~~~~~--~~-~~-~~v~v~v~~~~i~~~   39 (330)
T cd08245          11 PLEPEEVPVP--EP-GP-GEVLIKIEACGVCHT   39 (330)
T ss_pred             CceEEeccCC--CC-CC-CeEEEEEEEEeccHH
Confidence            5888777775  22 55 899999999999884


No 102
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catal
Probab=56.33  E-value=21  Score=25.65  Aligned_cols=29  Identities=14%  Similarity=0.192  Sum_probs=22.2

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ++++++.+.|  . .++ ||++||+.+.++.+.
T Consensus        12 ~~~~~~~~~p--~-~~~-~~v~v~v~~~~i~~~   40 (333)
T cd08296          12 PLELVERDVP--L-PGP-GEVLIKVEACGVCHS   40 (333)
T ss_pred             CceEEeccCC--C-CCC-CEEEEEEEEEecchH
Confidence            4778766665  2 255 899999999999875


No 103
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR). Zeta-crystallin is a eye lens protein with NADP-dependent quinone reductase activity (QOR). It has been cited as a structural component in mammalian eyes, but also has homology to quinone reductases in unrelated species. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  Alcohol dehydrogenase in the liver converts
Probab=55.85  E-value=39  Score=23.31  Aligned_cols=30  Identities=13%  Similarity=0.234  Sum_probs=22.0

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..|++.+.+.+  . ..+ +++++|..+.++++.
T Consensus        13 ~~~~~~~~~~~--~-l~~-~~v~i~v~~~~i~~~   42 (325)
T cd08253          13 DVLRLGDLPVP--T-PGP-GEVLVRVHASGVNPV   42 (325)
T ss_pred             ccceeeecCCC--C-CCC-CEEEEEEEEEecChh
Confidence            45777655554  2 355 899999999999884


No 104
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase. Glutathione-dependent formaldehyde dehydrogenases (FDHs, Class III ADH) are members of the zinc-dependent/medium chain alcohol dehydrogenase family.  FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also known as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to corresponding carboxylic acid and alcohol.  ADH is a me
Probab=55.19  E-value=25  Score=25.76  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=21.7

Q ss_pred             cEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           28 MKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        28 f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      +++++.++|  .+ ++ ++++||+++.++++.
T Consensus        13 ~~~~~~~~p--~~-~~-~~v~i~v~~~~i~~~   40 (363)
T cd08279          13 LEIEEVELD--DP-GP-GEVLVRIAAAGLCHS   40 (363)
T ss_pred             ceEEEeeCC--CC-CC-CeEEEEEEEeecCcH
Confidence            667666665  23 55 899999999999885


No 105
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family. This group contains proteins related to the zinc-dependent  alcohol dehydrogenases. However, while the group has structural zinc site characteristic of these enzymes, it lacks the consensus site for a catalytic zinc. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.   Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form.  The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone
Probab=53.84  E-value=23  Score=24.78  Aligned_cols=30  Identities=13%  Similarity=0.056  Sum_probs=22.1

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .++++.+.+.+  . ..+ ++++||+++.++.+.
T Consensus        13 ~~~~~~~~~~~--~-~~~-~~v~v~v~~~~i~~~   42 (342)
T cd08266          13 EVLEYGDLPEP--E-PGP-DEVLVRVKAAALNHL   42 (342)
T ss_pred             cceeEeecCCC--C-CCC-CeEEEEEEeeecCHH
Confidence            56777666554  2 255 899999999999863


No 106
>PLN02178 cinnamyl-alcohol dehydrogenase
Probab=53.04  E-value=43  Score=25.04  Aligned_cols=29  Identities=17%  Similarity=0.076  Sum_probs=20.2

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+++.+.+.|  .+ ++ ||||||+.+.++.+.
T Consensus        18 ~l~~~~~~~p--~~-~~-~eVlVkV~a~gic~s   46 (375)
T PLN02178         18 VLSPFHFSRR--EN-GE-NDVTVKILFCGVCHS   46 (375)
T ss_pred             CceEEeecCC--CC-CC-CeEEEEEEEEcCchH
Confidence            4555554443  23 66 899999999998664


No 107
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members. This group contains enzymes of the zinc-dependent alcohol dehydrogenase family, including members (aka MDR) identified as 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase and N-benzyl-3-pyrrolidinol dehydrogenase. 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase catalyzes the conversion of 6-Hydroxycyclohex-1-enecarbonyl-CoA and NAD+ to 6-Ketoxycyclohex-1-ene-1-carboxyl-CoA,NADH, and H+. This group displays the characteristic catalytic and structural zinc sites of the zinc-dependent alcohol dehydrogenases. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentatio
Probab=46.57  E-value=47  Score=23.41  Aligned_cols=29  Identities=14%  Similarity=0.061  Sum_probs=20.9

Q ss_pred             cEEEEeecccccCCCCCCeEEEEeEEEeeCcch
Q 039200           28 MKITSGSIKLKVADGSKDTVLLKNLYLSCGPYM   60 (88)
Q Consensus        28 f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~   60 (88)
                      |++.+.+.|  . .++ ++++||..+.++++.-
T Consensus        14 ~~~~~~~~~--~-~~~-~~v~i~v~~~~~~~~d   42 (338)
T cd08254          14 LVLEEVPVP--E-PGP-GEVLVKVKAAGVCHSD   42 (338)
T ss_pred             eEEeccCCC--C-CCC-CeEEEEEEEEeeccHh
Confidence            566555443  2 355 8999999999999863


No 108
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]
Probab=46.30  E-value=37  Score=26.35  Aligned_cols=34  Identities=9%  Similarity=0.060  Sum_probs=24.6

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEee---Ccchhhh
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSC---GPYMRER   63 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSv---DPy~R~~   63 (88)
                      .-|+++|..++  .| +. ||||||...--+   |.|.|.-
T Consensus        13 ~Pl~i~ei~l~--~P-~~-gEVlVri~AtGVCHTD~~~~~G   49 (366)
T COG1062          13 KPLEIEEVDLD--PP-RA-GEVLVRITATGVCHTDAHTLSG   49 (366)
T ss_pred             CCeEEEEEecC--CC-CC-CeEEEEEEEeeccccchhhhcC
Confidence            45889888775  33 55 899999987655   6666653


No 109
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH.  MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR).  The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.  The MDR group contains a host of activities, including the founding alcoh
Probab=41.72  E-value=1.2e+02  Score=20.98  Aligned_cols=30  Identities=13%  Similarity=0.193  Sum_probs=21.4

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..+++.+.+.+  . .++ ++++||+.+.+++..
T Consensus        13 ~~~~~~~~~~~--~-~~~-~~v~i~v~~~~~~~~   42 (328)
T cd08268          13 EVLRIEELPVP--A-PGA-GEVLIRVEAIGLNRA   42 (328)
T ss_pred             ceeEEeecCCC--C-CCC-CeEEEEEEEEecChH
Confidence            45666655554  2 255 899999999999863


No 110
>cd08241 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group.  NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones.  Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic
Probab=41.18  E-value=87  Score=21.50  Aligned_cols=30  Identities=7%  Similarity=-0.031  Sum_probs=20.9

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      .+|++.+.+ +  .+..+ +++++|.++.++.+.
T Consensus        13 ~~~~~~~~~-~--~~~~~-~~v~i~v~~~~i~~~   42 (323)
T cd08241          13 EDLVLEEVP-P--EPGAP-GEVRIRVEAAGVNFP   42 (323)
T ss_pred             ceeEEecCC-C--CCCCC-CeEEEEEEEEecCHH
Confidence            457776655 4  23234 799999999999654


No 111
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only]
Probab=40.26  E-value=62  Score=24.45  Aligned_cols=47  Identities=19%  Similarity=0.107  Sum_probs=28.6

Q ss_pred             eeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhh
Q 039200            9 SNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRE   62 (88)
Q Consensus         9 ~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~   62 (88)
                      .++++.+.+.+.+.   +.-..++.++|  .| .+ +++++|+....++|.=.-
T Consensus         4 ~~~~~~~~~~~~~~---~~~~~~~~~iP--~~-~~-~~~~i~~~a~a~NpiD~~   50 (347)
T KOG1198|consen    4 KIRRVSLVSPPGGG---EVLFSEEVPIP--EP-ED-GEVLIKVVAVALNPIDLK   50 (347)
T ss_pred             ccceEEEeccCCCc---ceEEeecccCC--CC-CC-CceEEEEEEeccChHHHH
Confidence            35666666665542   22233344554  33 44 799999999999775433


No 112
>KOG3451 consensus Uncharacterized conserved protein [Function unknown]
Probab=38.22  E-value=18  Score=21.59  Aligned_cols=15  Identities=13%  Similarity=0.603  Sum_probs=11.8

Q ss_pred             EEEeeCcchhhhccC
Q 039200           52 LYLSCGPYMRERMSK   66 (88)
Q Consensus        52 l~lSvDPy~R~~m~~   66 (88)
                      ++++|||.+|..+-.
T Consensus         8 vlV~cDp~~kqliln   22 (71)
T KOG3451|consen    8 VLVTCDPAFKQLILN   22 (71)
T ss_pred             eEEecChhHHHHhhh
Confidence            466799999988743


No 113
>cd05286 QOR2 Quinone oxidoreductase (QOR). Quinone oxidoreductase (QOR) and 2-haloacrylate reductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds.  Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. 2-haloacrylate reductase, a member of this subgroup, catalyzes the NADPH-dependent reduction of a carbon-carbon double bond in organohalogen compounds. Although similar to QOR, Burkholderia 2-haloacrylate reductase does not act on the quinones 1,4-benzoquinone 
Probab=34.38  E-value=67  Score=21.98  Aligned_cols=30  Identities=13%  Similarity=0.204  Sum_probs=21.3

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..|++.+.+.+   ..++ |++++|+++.+++..
T Consensus        12 ~~~~~~~~~~~---~~~~-~~v~i~v~~~~i~~~   41 (320)
T cd05286          12 EVLEYEDVPVP---EPGP-GEVLVRNTAIGVNFI   41 (320)
T ss_pred             cceEEeecCCC---CCCC-CEEEEEEEEeecCHH
Confidence            45666655543   2355 899999999998764


No 114
>PF04648 MF_alpha:  Yeast mating factor alpha hormone;  InterPro: IPR006742 This repeated sequence,WHWLQLKPGQPMY, characterises the mating factor alpha-1 or alpha-1 mating pheromone [contains: Mating factor alpha].The hormone is excreted into the culture medium by haploid cells of the alpha mating type and acts on cells of the opposite mating type (type A) by binding to a cognate G-protein coupled receptor which is coupled to a downstream signal transduction pathway. It inhibits DNA synthesis in type A cells synchronising them with type alpha, and so mediates the conjugation process.; GO: 0000772 mating pheromone activity, 0019953 sexual reproduction, 0005576 extracellular region
Probab=32.91  E-value=18  Score=14.77  Aligned_cols=6  Identities=33%  Similarity=0.800  Sum_probs=2.7

Q ss_pred             EEeeCc
Q 039200           53 YLSCGP   58 (88)
Q Consensus        53 ~lSvDP   58 (88)
                      |||+||
T Consensus         3 WL~~~~    8 (13)
T PF04648_consen    3 WLRLSP    8 (13)
T ss_pred             ceeccC
Confidence            444444


No 115
>PF10736 DUF2527:  Protein of unknown function (DUF2627) ;  InterPro: IPR019672  This entry represents small proteins with unknown function and appear to be restricted to a family of Enterobacterial proteins. It has a highly conserved sequence. Some proteins are annotated as YobF and may be involved in stress responses in E. coli.
Probab=31.46  E-value=22  Score=18.54  Aligned_cols=15  Identities=27%  Similarity=0.490  Sum_probs=11.6

Q ss_pred             EEEeeCcchhhhccC
Q 039200           52 LYLSCGPYMRERMSK   66 (88)
Q Consensus        52 l~lSvDPy~R~~m~~   66 (88)
                      -++|-|||++.-.+.
T Consensus        18 y~FsAdpy~~AS~SN   32 (38)
T PF10736_consen   18 YHFSADPYLSASSSN   32 (38)
T ss_pred             EEEecCceeeccccc
Confidence            468999999986543


No 116
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family. Members of this family are putative quinone oxidoreductases that belong to the broader superfamily (modeled by Pfam pfam00107) of zinc-dependent alcohol (of medium chain length) dehydrogenases and quinone oxiooreductases. The alignment shows no motif of conserved Cys residues as are found in zinc-binding members of the superfamily, and members are likely to be quinone oxidoreductases instead. A member of this family in Homo sapiens, PIG3, is induced by p53 but is otherwise uncharacterized.
Probab=30.55  E-value=1e+02  Score=21.21  Aligned_cols=30  Identities=7%  Similarity=0.036  Sum_probs=21.4

Q ss_pred             CCcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           26 SDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        26 ~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      ..|++.+.+.+   +.++ +++++|+++.++++.
T Consensus        13 ~~~~~~~~~~~---~l~~-~~v~i~v~~~~~~~~   42 (325)
T TIGR02824        13 EVLVLVEVPLP---VPKA-GEVLIRVAAAGVNRP   42 (325)
T ss_pred             ccceEEeCCCC---CCCC-CEEEEEEEEEecCHH
Confidence            55666555443   2355 899999999999864


No 117
>COG3085 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.62  E-value=15  Score=23.54  Aligned_cols=28  Identities=21%  Similarity=0.412  Sum_probs=21.2

Q ss_pred             eeeeEEEEccCCCCCCCCCCcEEEEeec
Q 039200            8 VSNKRVILSNYVTGFPNESDMKITSGSI   35 (88)
Q Consensus         8 ~~n~~vvl~~~P~g~p~~~~f~l~~~~~   35 (88)
                      ++||-.==+++|.|+-...||+|.|.++
T Consensus         7 ~t~RfFD~K~yPRGFsrhGDfTikE~q~   34 (112)
T COG3085           7 TTNRFFDNKHYPRGFSRHGDFTIKEAQL   34 (112)
T ss_pred             hhhhccccCcCCCcccccCCeehhHHHH
Confidence            3444334477999999999999998876


No 118
>PF06331 Tbf5:  Transcription factor TFIIH complex subunit Tfb5;  InterPro: IPR009400  This entry represents nucleotide excision repair (NER) proteins, such as TTDA subunit of TFIIH basal transcription factor complex (also known as subunit 5 of RNA polymerase II transcription factor B), and Rex1. These proteins have a structural motif consisting of a 2-layer sandwich structure with an alpha/beta plait topology. Nucleotide excision repair is a major pathway for repairing UV light-induced DNA damage in most organisms. Transcription/repair factor IIH (TFIIH) is essential for RNA polymerase II transcription and nucleotide excision repair. The TFIIH complex consists of ten subunits: ERCC2, ERCC3, GTF2H1, GTF2H2, GTF2H3, GTF2H4, GTF2H5, MNAT1, CDK7 and CCNH. Defects in GTF2H5 cause the disease trichothiodystrophy (TTD), therefore GTF2H5 (general transcription factor 2H subunit 5) is also known as the TTD group A (TTDA) subunit (and as Tfb5) []. The TTDA subunit is responsible for the DNA repair function of the complex. TTDA is present both bound to TFIIH, and as a free fraction that shuffles between the cytoplasm and nucleus; induction of NER-type DNA lesions shifts the balance towards TTDA's more stable association with TFIIH []. TTDA is also required for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.  REX1 (required for excision 1) is required for DNA repair in the single-celled, photosynthetic algae Chlamydomonas reinhardtii [], and has homologues in other eukaryotes.; GO: 0003677 DNA binding, 0006289 nucleotide-excision repair; PDB: 2JNJ_B 1YDL_A 3DGP_B 3DOM_B.
Probab=29.60  E-value=37  Score=19.97  Aligned_cols=16  Identities=19%  Similarity=0.696  Sum_probs=11.6

Q ss_pred             EEeEEEeeCcchhhhc
Q 039200           49 LKNLYLSCGPYMRERM   64 (88)
Q Consensus        49 vr~l~lSvDPy~R~~m   64 (88)
                      +|-.+++|||.++-.+
T Consensus         5 ~kGvLv~CDpa~Kq~i   20 (68)
T PF06331_consen    5 IKGVLVECDPAIKQFI   20 (68)
T ss_dssp             EEEEEEES-HHHHHHH
T ss_pred             eeeEEEEcCHHHHHHH
Confidence            5666778999998765


No 119
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism]
Probab=28.24  E-value=1.1e+02  Score=23.74  Aligned_cols=29  Identities=14%  Similarity=0.026  Sum_probs=20.9

Q ss_pred             CcEEEEeecccccCCCCCCeEEEEeEEEeeCcc
Q 039200           27 DMKITSGSIKLKVADGSKDTVLLKNLYLSCGPY   59 (88)
Q Consensus        27 ~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy   59 (88)
                      -|.++|..++  .| +. .||.+|++|-|+=.+
T Consensus        19 PL~IEei~V~--pP-ka-~EVRIKI~~t~vCHT   47 (375)
T KOG0022|consen   19 PLVIEEIEVA--PP-KA-HEVRIKILATGVCHT   47 (375)
T ss_pred             CeeEEEEEeC--CC-CC-ceEEEEEEEEeeccc
Confidence            4677777775  23 44 799999999998433


No 120
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only]
Probab=28.03  E-value=55  Score=24.84  Aligned_cols=48  Identities=15%  Similarity=0.284  Sum_probs=31.0

Q ss_pred             eeeEEEEccCCCCCCCCCCcEEEEeecccccCCCCCCeEEEEeEEEee---Ccchhhhc
Q 039200            9 SNKRVILSNYVTGFPNESDMKITSGSIKLKVADGSKDTVLLKNLYLSC---GPYMRERM   64 (88)
Q Consensus         9 ~n~~vvl~~~P~g~p~~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSv---DPy~R~~m   64 (88)
                      .+|-+++.+. .|   .+-.++++.+++  .| .+ ||+++||.|..+   |-|.|--+
T Consensus         8 ~~k~i~v~e~-Gg---ydvlk~ed~pv~--~p-ap-gel~iknka~GlNfid~y~RkGl   58 (336)
T KOG1197|consen    8 LLKCIVVTEF-GG---YDVLKLEDRPVP--PP-AP-GELTIKNKACGLNFIDLYFRKGL   58 (336)
T ss_pred             hheEEEEecc-CC---cceEEEeeecCC--CC-CC-CceEEeehhcCccHHHHHHhccc
Confidence            4555554332 22   356788888886  23 44 899999999885   56666543


No 121
>PF03345 DDOST_48kD:  Oligosaccharyltransferase 48 kDa subunit beta;  InterPro: IPR005013 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins [, ]. The oligosaccharyl transferase complex (OST complex) 2.4.1.119 from EC transfers 14-sugar branched oligosaccharides from dolichyl pyrophosphate to asparagine residues []. The complex contains nine protein subunits: Ost1p, Ost2p, Ost3p, Ost4p, Ost5p, Ost6p, Stt3p, Swp1p, and Wbp1p, all of which are integral membrane proteins of the ER. The OST complex interacts with the Sec61p pore complex [] involved in protein import into the ER. This entry represents subunits OST3 and OST6. OST3 is homologous to OST6 [], and several lines of evidence indicate that they are alternative members of the OST complex. Disruption of both OST3 and OST6 causes severe underglycosylation of soluble and membrane-bound glycoproteins and a defect in the assembly of the complex. Hence, the function of these genes seems to be essential for recruiting a fully active complex necessary for efficient N-glycosylation []. This entry also includes the magnesium transporter protein 1, also known as OST3 homologue B, which might be involved in N-glycosylation through its association with the oligosaccharyl transferase (OST) complex. Wbp1p is the beta subunit of the OST complex, one of the original six subunits purified []. Wbp1 is essential [, ], but conditional mutants have decreased transferase activity [, ]. Wbp1p is homologous to mammalian OST48 [].; GO: 0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity, 0018279 protein N-linked glycosylation via asparagine, 0005789 endoplasmic reticulum membrane
Probab=27.76  E-value=34  Score=26.88  Aligned_cols=33  Identities=21%  Similarity=0.473  Sum_probs=22.1

Q ss_pred             CeEEEEeEEEeeCcchhhhccC----CCCCCccCCCCCC
Q 039200           45 DTVLLKNLYLSCGPYMRERMSK----LDRPSFVDSFHPG   79 (88)
Q Consensus        45 gevLvr~l~lSvDPy~R~~m~~----~~~~~Y~~p~~~G   79 (88)
                      ++|-++  |.-+|||.|.-|..    .+...|...|++=
T Consensus       305 dDiQlE--f~mLDPy~R~~L~~~~~~~~~~~Y~~~FklP  341 (423)
T PF03345_consen  305 DDIQLE--FVMLDPYVRLTLKPSYSTDDNGTYSTTFKLP  341 (423)
T ss_pred             CcEEEE--EEEcCcEEEcccccccccCCCCEEEEEEECC
Confidence            355554  99999999999986    2233465555543


No 122
>KOG2754 consensus Oligosaccharyltransferase, beta subunit [Posttranslational modification, protein turnover, chaperones]
Probab=25.94  E-value=43  Score=26.40  Aligned_cols=32  Identities=13%  Similarity=0.321  Sum_probs=22.6

Q ss_pred             EEeEEEeeCcchhhhccCCCCCCccCCCCCCC
Q 039200           49 LKNLYLSCGPYMRERMSKLDRPSFVDSFHPGG   80 (88)
Q Consensus        49 vr~l~lSvDPy~R~~m~~~~~~~Y~~p~~~G~   80 (88)
                      |+..+.-+|||.|..++......|...|++=|
T Consensus       332 vQlEfv~iDPyvR~tL~~~~~g~~~~~FklPD  363 (443)
T KOG2754|consen  332 VQLEFVRIDPYVRTTLKPSGQGYYSAEFKLPD  363 (443)
T ss_pred             eEEEEEEeCchheeEEecCCCceEEEEEecCC
Confidence            45559999999999998754344655565544


No 123
>PF05958 tRNA_U5-meth_tr:  tRNA (Uracil-5-)-methyltransferase;  InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2.1.1.35 from EC from bacteria, archaea and eukaryotes. A 5-methyluridine (m(5)U) residue at position 54 is a conserved feature of bacterial and eukaryotic tRNAs. The methylation of U54 is catalysed by the tRNA(m5U54)methyltransferase, which in Saccharomyces cerevisiae is encoded by the nonessential TRM2 gene. It is thought that tRNA modification enzymes might have a role in tRNA maturation not necessarily linked to their known catalytic activity []. This protein family also contains the 23SrRNA methyltransferases, first proposed to be RNA methyltransferases by homology to the TrmA family. The member from Escherichia coli has now been shown to act as the 23S RNA methyltransferase for the conserved U1939. The gene is now designated rumA and was previously designated ygcA [].; GO: 0008173 RNA methyltransferase activity, 0006396 RNA processing; PDB: 2VS1_A 2JJQ_A 2BH2_A 1UWV_A 3BT7_B.
Probab=25.82  E-value=39  Score=25.39  Aligned_cols=14  Identities=36%  Similarity=0.778  Sum_probs=10.4

Q ss_pred             EeEEEeeCcchhhh
Q 039200           50 KNLYLSCGPYMRER   63 (88)
Q Consensus        50 r~l~lSvDPy~R~~   63 (88)
                      |.+|+||||..-.|
T Consensus       304 ~ivYvSCnP~tlaR  317 (352)
T PF05958_consen  304 RIVYVSCNPATLAR  317 (352)
T ss_dssp             EEEEEES-HHHHHH
T ss_pred             eEEEEECCHHHHHH
Confidence            78999999976554


No 124
>PF02630 SCO1-SenC:  SCO1/SenC;  InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems. In yeast the SCO1 protein is specifically required for a post-translational step in the accumulation of subunits 1 and 2 of cytochrome c oxidase (COXI and COX-II) []. It is a mitochondrion-associated cytochrome c oxidase assembly factor. The purple nonsulphur photosynthetic eubacterium Rhodobacter capsulatus is a versatile organism that can obtain cellular energy by several means, including the capture of light energy for photosynthesis as well as the use of light-independent respiration, in which molecular oxygen serves as a terminal electron acceptor. The SenC protein is required for optimal cytochrome c oxidase activity in aerobically grown R. capsulatus cells and is involved in the induction of structural polypeptides of the light-harvesting and reaction centre complexes [].; PDB: 2K6V_A 3ME8_A 3ME7_A 2GT6_A 2GQL_A 2GQK_A 2GGT_B 1WP0_C 2HRN_A 2GQM_A ....
Probab=24.75  E-value=53  Score=22.00  Aligned_cols=11  Identities=18%  Similarity=0.519  Sum_probs=9.9

Q ss_pred             EEeEEEeeCcc
Q 039200           49 LKNLYLSCGPY   59 (88)
Q Consensus        49 vr~l~lSvDPy   59 (88)
                      |+.+++|+||.
T Consensus        89 v~~v~ISvDP~   99 (174)
T PF02630_consen   89 VQFVFISVDPE   99 (174)
T ss_dssp             EEEEEEESSTT
T ss_pred             eEEEEEEeCCC
Confidence            78999999996


No 125
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only]
Probab=24.69  E-value=57  Score=22.76  Aligned_cols=14  Identities=7%  Similarity=0.223  Sum_probs=12.1

Q ss_pred             eEEEEeEEEeeCcc
Q 039200           46 TVLLKNLYLSCGPY   59 (88)
Q Consensus        46 evLvr~l~lSvDPy   59 (88)
                      ..-|+.+++|+||.
T Consensus       102 ~~~v~vv~itvDPe  115 (207)
T COG1999         102 GDDVQVVFITVDPE  115 (207)
T ss_pred             CCCEEEEEEEECCC
Confidence            56689999999996


No 126
>PF09493 DUF2389:  Tryptophan-rich protein (DUF2389);  InterPro: IPR012663 Members of this family are small hypothetical proteins of 60 to 100 residues from Cyanobacteria and some Proteobacteria. Prochlorococcus marinus strains have two members, other species one only. Interestingly, of the eight most conserved residues, four are aromatic and three are invariant tryptophans. It appears all species that encode this protein can synthesize tryptophan de novo.
Probab=24.04  E-value=1.2e+02  Score=17.18  Aligned_cols=33  Identities=15%  Similarity=0.091  Sum_probs=25.2

Q ss_pred             CCCcEEEEeecccccCCCCCCeEEEEeEEEeeCcchhhhcc
Q 039200           25 ESDMKITSGSIKLKVADGSKDTVLLKNLYLSCGPYMRERMS   65 (88)
Q Consensus        25 ~~~f~l~~~~~~~~~~~~~~gevLvr~l~lSvDPy~R~~m~   65 (88)
                      .-||.+.+...+     +  ++..+. +.-.||+..|.+++
T Consensus        13 ~rHF~V~~~~~~-----~--~~~~v~-~~~av~~~~~~~i~   45 (60)
T PF09493_consen   13 ERHFLVTNVEGD-----E--DGRVVE-LVEAVDSKRRFWIN   45 (60)
T ss_pred             cEEEEEEEEeec-----C--CCeEEE-eEeeeccCcEEEEe
Confidence            479999877653     3  356677 88899999999886


No 127
>PF11826 DUF3346:  Protein of unknown function (DUF3346);  InterPro: IPR021781  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 231 to 659 amino acids in length. 
Probab=22.99  E-value=54  Score=23.48  Aligned_cols=45  Identities=20%  Similarity=0.375  Sum_probs=28.0

Q ss_pred             eEEEEccCCCCCCCCCCcEEEEeecccc--cC-CCCCCeEEEE-eEEEee
Q 039200           11 KRVILSNYVTGFPNESDMKITSGSIKLK--VA-DGSKDTVLLK-NLYLSC   56 (88)
Q Consensus        11 ~~vvl~~~P~g~p~~~~f~l~~~~~~~~--~~-~~~~gevLvr-~l~lSv   56 (88)
                      -+|+--+.|.| .+.++|++.-.++...  +| .|+.||+-+| |||+-+
T Consensus        11 grwlseNMPeG-FksdrFrfiartiTaSeeAP~eg~dgEi~ikPnLYilv   59 (225)
T PF11826_consen   11 GRWLSENMPEG-FKSDRFRFIARTITASEEAPKEGEDGEIRIKPNLYILV   59 (225)
T ss_pred             hhhhhhcCCCc-ccccchhhhhhhhhccccCCcCCCCCceEecccEEEEE
Confidence            46888889999 5778887655544321  23 2333788877 566543


Done!