BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039206
(645 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2PMP|A Chain A, Structure Of 2c-Methyl-D-Erythritol 2,4-Cyclodiphosphate
Synthase From The Isoprenoid Biosynthetic Pathway Of
Arabidopsis Thaliana
Length = 160
Score = 29.6 bits (65), Expect = 5.7, Method: Composition-based stats.
Identities = 14/37 (37%), Positives = 23/37 (62%)
Query: 72 KQSSSSIDVDMKIRLLDERAKEIENKESELVLVEKKI 108
K ++SS+ + +RL+DE EI N ++ L+L KI
Sbjct: 72 KGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKI 108
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.132 0.359
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,073,687
Number of Sequences: 62578
Number of extensions: 526490
Number of successful extensions: 1938
Number of sequences better than 100.0: 48
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 43
Number of HSP's that attempted gapping in prelim test: 1889
Number of HSP's gapped (non-prelim): 84
length of query: 645
length of database: 14,973,337
effective HSP length: 105
effective length of query: 540
effective length of database: 8,402,647
effective search space: 4537429380
effective search space used: 4537429380
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)