BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039234
(94 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|B8MTH6|DAPB_TALSN Probable dipeptidyl-aminopeptidase B OS=Talaromyces stipitatus
(strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
GN=dapB PE=3 SV=1
Length = 900
Score = 29.3 bits (64), Expect = 6.6, Method: Composition-based stats.
Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
Query: 30 YGRVMEGLLGNSGREEFSIEEVRSKKENEEENVWVFVLLGLG---LAYFLFW 78
Y + EG+ G + S +SK+ +WV LL LG LA+ LFW
Sbjct: 60 YRDIEEGVEGEPESDILSHPRDKSKRSRGSRWIWVIGLLCLGGWILAFILFW 111
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.318 0.137 0.393
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,213,107
Number of Sequences: 539616
Number of extensions: 1212549
Number of successful extensions: 3133
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 3128
Number of HSP's gapped (non-prelim): 9
length of query: 94
length of database: 191,569,459
effective HSP length: 64
effective length of query: 30
effective length of database: 157,034,035
effective search space: 4711021050
effective search space used: 4711021050
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)