BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039234
         (94 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|B8MTH6|DAPB_TALSN Probable dipeptidyl-aminopeptidase B OS=Talaromyces stipitatus
           (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)
           GN=dapB PE=3 SV=1
          Length = 900

 Score = 29.3 bits (64), Expect = 6.6,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 30  YGRVMEGLLGNSGREEFSIEEVRSKKENEEENVWVFVLLGLG---LAYFLFW 78
           Y  + EG+ G    +  S    +SK+      +WV  LL LG   LA+ LFW
Sbjct: 60  YRDIEEGVEGEPESDILSHPRDKSKRSRGSRWIWVIGLLCLGGWILAFILFW 111


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.318    0.137    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 33,213,107
Number of Sequences: 539616
Number of extensions: 1212549
Number of successful extensions: 3133
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 3128
Number of HSP's gapped (non-prelim): 9
length of query: 94
length of database: 191,569,459
effective HSP length: 64
effective length of query: 30
effective length of database: 157,034,035
effective search space: 4711021050
effective search space used: 4711021050
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)