BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039238
         (417 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XEA|A Chain A, Crystal Structure Of A Gfo/idh/moca Family Oxidoreductase
           From Vibrio Cholerae
 pdb|1XEA|B Chain B, Crystal Structure Of A Gfo/idh/moca Family Oxidoreductase
           From Vibrio Cholerae
 pdb|1XEA|C Chain C, Crystal Structure Of A Gfo/idh/moca Family Oxidoreductase
           From Vibrio Cholerae
 pdb|1XEA|D Chain D, Crystal Structure Of A Gfo/idh/moca Family Oxidoreductase
           From Vibrio Cholerae
          Length = 323

 Score = 29.3 bits (64), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 29/51 (56%)

Query: 274 TKGRRWRAMAKNRVSENNGASSMSSRRFYRLDQDELRSRSEGQVSTEGLEK 324
           T+G+ WR   ++RV+  +    ++S+ F    QD L+  + G++ T  +E+
Sbjct: 241 TQGKXWRDNQESRVALKDWTPXLASKGFDAXVQDWLQVAAAGKLPTHIIER 291


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.306    0.124    0.327 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,785,107
Number of Sequences: 62578
Number of extensions: 407142
Number of successful extensions: 972
Number of sequences better than 100.0: 48
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 40
Number of HSP's that attempted gapping in prelim test: 950
Number of HSP's gapped (non-prelim): 58
length of query: 417
length of database: 14,973,337
effective HSP length: 101
effective length of query: 316
effective length of database: 8,652,959
effective search space: 2734335044
effective search space used: 2734335044
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 53 (25.0 bits)