BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039249
         (91 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|B Chain B, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|C Chain C, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|D Chain D, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|E Chain E, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|F Chain F, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|G Chain G, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|H Chain H, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|I Chain I, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|J Chain J, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|K Chain K, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|L Chain L, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|M Chain M, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|N Chain N, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|O Chain O, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|P Chain P, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|Q Chain Q, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|R Chain R, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|S Chain S, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|T Chain T, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|U Chain U, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|V Chain V, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|W Chain W, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|X Chain X, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|Y Chain Y, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|Z Chain Z, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|AA Chain a, The Structure Of A V6a Variant Of Clpp.
 pdb|1YG8|BB Chain b, The Structure Of A V6a Variant Of Clpp
          Length = 193

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (68%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQATD+EI  +EI  VK  + +L A H G++ EQIE D  R ++ S  EA
Sbjct: 120 MIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEA 179

Query: 61  VEYGIMDKVL 70
           VEYG++D +L
Sbjct: 180 VEYGLVDSIL 189


>pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|B Chain B, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|C Chain C, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|D Chain D, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|E Chain E, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|F Chain F, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|G Chain G, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|H Chain H, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|I Chain I, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|J Chain J, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|K Chain K, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|L Chain L, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|M Chain M, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1TYF|N Chain N, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests
           A Model For Atp-Dependent Proteolysis
 pdb|1YG6|A Chain A, Clpp
 pdb|1YG6|B Chain B, Clpp
 pdb|1YG6|C Chain C, Clpp
 pdb|1YG6|D Chain D, Clpp
 pdb|1YG6|E Chain E, Clpp
 pdb|1YG6|F Chain F, Clpp
 pdb|1YG6|G Chain G, Clpp
 pdb|1YG6|H Chain H, Clpp
 pdb|1YG6|I Chain I, Clpp
 pdb|1YG6|J Chain J, Clpp
 pdb|1YG6|K Chain K, Clpp
 pdb|1YG6|L Chain L, Clpp
 pdb|1YG6|M Chain M, Clpp
 pdb|1YG6|N Chain N, Clpp
 pdb|2FZS|A Chain A, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|B Chain B, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|C Chain C, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|D Chain D, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|E Chain E, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|F Chain F, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|G Chain G, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|H Chain H, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|I Chain I, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|J Chain J, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|K Chain K, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|L Chain L, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|M Chain M, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
 pdb|2FZS|N Chain N, Crystal Structure Of E. Coli Clpp With A Peptide
           Chloromethyl Ketone Covalently Bound At The Active Site
          Length = 193

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (68%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQATD+EI  +EI  VK  + +L A H G++ EQIE D  R ++ S  EA
Sbjct: 120 MIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEA 179

Query: 61  VEYGIMDKVL 70
           VEYG++D +L
Sbjct: 180 VEYGLVDSIL 189


>pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|S Chain S, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|T Chain T, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|U Chain U, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|O Chain O, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|P Chain P, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|Q Chain Q, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|Y Chain Y, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|Z Chain Z, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|AA Chain a, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|BB Chain b, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|V Chain V, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|W Chain W, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|X Chain X, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|M Chain M, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|L Chain L, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|K Chain K, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|J Chain J, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|I Chain I, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|H Chain H, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|N Chain N, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|F Chain F, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|E Chain E, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|D Chain D, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|C Chain C, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|B Chain B, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|A Chain A, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
 pdb|3MT6|G Chain G, Structure Of Clpp From Escherichia Coli In Complex With
           Adep1
          Length = 207

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (68%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQATD+EI  +EI  VK  + +L A H G++ EQIE D  R ++ S  EA
Sbjct: 134 MIHQPLGGYQGQATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEA 193

Query: 61  VEYGIMDKVL 70
           VEYG++D +L
Sbjct: 194 VEYGLVDSIL 203


>pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|B Chain B, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|C Chain C, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|D Chain D, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|E Chain E, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|F Chain F, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|G Chain G, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|H Chain H, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|I Chain I, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|J Chain J, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|K Chain K, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|L Chain L, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|M Chain M, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|N Chain N, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|O Chain O, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|P Chain P, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|Q Chain Q, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|R Chain R, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|S Chain S, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|T Chain T, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|U Chain U, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|V Chain V, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|W Chain W, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|X Chain X, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|Y Chain Y, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|Z Chain Z, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|1 Chain 1, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
 pdb|3HLN|2 Chain 2, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer
           Disulfide Bonds
          Length = 193

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (68%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQATD+EI  +EI  VK  + +L A H G++ EQIE D  R ++ S  EA
Sbjct: 120 MIHQPLGGYQGQATDIEIHCREILKVKGRMNELMALHTGQSLEQIERDTERDRFLSAPEA 179

Query: 61  VEYGIMDKVL 70
           VEYG++D +L
Sbjct: 180 VEYGLVDSIL 189


>pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|B Chain B, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|C Chain C, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|D Chain D, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|E Chain E, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|F Chain F, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
 pdb|1TG6|G Chain G, Crystallography And Mutagenesis Point To An Essential Role
           For The N- Terminus Of Human Mitochondrial Clpp
          Length = 277

 Score = 69.7 bits (169), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/70 (48%), Positives = 47/70 (67%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP G   GQATD+ I  +EI  +K +L  +YAKH  ++ + IE+ + R +Y SP EA
Sbjct: 176 MIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEA 235

Query: 61  VEYGIMDKVL 70
            E+GI+DKVL
Sbjct: 236 QEFGILDKVL 245


>pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|B Chain B, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|C Chain C, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|D Chain D, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|E Chain E, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|F Chain F, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|G Chain G, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|H Chain H, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|I Chain I, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|J Chain J, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|K Chain K, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|L Chain L, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|M Chain M, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL0|N Chain N, Crystal Structure Of H.Pylori Clpp
 pdb|2ZL2|A Chain A, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|B Chain B, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|C Chain C, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|D Chain D, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|E Chain E, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|F Chain F, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|G Chain G, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|H Chain H, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|I Chain I, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|J Chain J, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|K Chain K, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|L Chain L, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|M Chain M, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
 pdb|2ZL2|N Chain N, Crystal Structure Of H.Pylori Clpp In Complex With The
           Peptide Nvlgftq
          Length = 196

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 45/70 (64%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQA+D+EI   EI  +K  +  + A++ G++ EQI  D  R  Y S  EA
Sbjct: 122 MIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQSLEQIAKDTDRDFYMSAKEA 181

Query: 61  VEYGIMDKVL 70
            EYG++DKVL
Sbjct: 182 KEYGLIDKVL 191


>pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|B Chain B, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|C Chain C, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|D Chain D, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|E Chain E, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|F Chain F, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|G Chain G, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|H Chain H, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|I Chain I, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|J Chain J, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|K Chain K, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|L Chain L, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|M Chain M, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL3|N Chain N, Crystal Structure Of H.Pylori Clpp S99a
 pdb|2ZL4|A Chain A, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|B Chain B, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|C Chain C, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|D Chain D, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|E Chain E, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|F Chain F, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|G Chain G, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|H Chain H, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|I Chain I, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|J Chain J, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|K Chain K, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|L Chain L, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|M Chain M, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
 pdb|2ZL4|N Chain N, Crystal Structure Of H.Pylori Clpp S99a In Complex With
           The Peptide Aaaa
          Length = 196

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 45/70 (64%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQA+D+EI   EI  +K  +  + A++ G++ EQI  D  R  Y S  EA
Sbjct: 122 MIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSGQSLEQIAKDTDRDFYMSAKEA 181

Query: 61  VEYGIMDKVL 70
            EYG++DKVL
Sbjct: 182 KEYGLIDKVL 191


>pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|B Chain B, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|C Chain C, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|D Chain D, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|E Chain E, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|F Chain F, Structure Of Clpp In Complex With Adep1
 pdb|3KTI|G Chain G, Structure Of Clpp In Complex With Adep1
 pdb|3KTJ|A Chain A, Structure Of Clpp In Complex With Adep2 In Monoclinic
           Crystal Form
 pdb|3KTJ|B Chain B, Structure Of Clpp In Complex With Adep2 In Monoclinic
           Crystal Form
 pdb|3KTJ|C Chain C, Structure Of Clpp In Complex With Adep2 In Monoclinic
           Crystal Form
 pdb|3KTJ|D Chain D, Structure Of Clpp In Complex With Adep2 In Monoclinic
           Crystal Form
 pdb|3KTJ|E Chain E, Structure Of Clpp In Complex With Adep2 In Monoclinic
           Crystal Form
 pdb|3KTJ|F Chain F, Structure Of Clpp In Complex With Adep2 In Monoclinic
           Crystal Form
 pdb|3KTJ|G Chain G, Structure Of Clpp In Complex With Adep2 In Monoclinic
           Crystal Form
 pdb|3KTK|A Chain A, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|B Chain B, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|C Chain C, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|D Chain D, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|E Chain E, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|F Chain F, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|G Chain G, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|H Chain H, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|I Chain I, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|J Chain J, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|K Chain K, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|L Chain L, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|M Chain M, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
 pdb|3KTK|N Chain N, Structure Of Clpp In Complex With Adep2 In Triclinic
           Crystal Form
          Length = 199

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 51/80 (63%), Gaps = 1/80 (1%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQAT++EIA K I  ++ +L K+ A+  G+  E IE D  R  + S  EA
Sbjct: 120 MIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEA 179

Query: 61  VEYGIMDKVL-YTEKSPEDH 79
           +EYG++DK+L +TE     H
Sbjct: 180 LEYGLIDKILTHTEDKKHHH 199


>pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|B Chain B, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|C Chain C, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|D Chain D, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|E Chain E, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|F Chain F, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|G Chain G, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|H Chain H, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|I Chain I, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|J Chain J, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|K Chain K, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|L Chain L, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|M Chain M, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
 pdb|3Q7H|N Chain N, Structure Of The Clpp Subunit Of The Atp-Dependent Clp
           Protease From Coxiella Burnetii
          Length = 195

 Score = 63.2 bits (152), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%)

Query: 2   IKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAV 61
           I Q +G  +GQ TD++I  K+ + V  +L ++ AKH GK  E++E D  R  + +P EAV
Sbjct: 123 IHQVLGGYQGQGTDIQIHAKQTQRVSDQLNQILAKHTGKDIERVEKDTNRDYFLTPEEAV 182

Query: 62  EYGIMDKVL 70
           EYG++D + 
Sbjct: 183 EYGLIDSIF 191


>pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed
           State
 pdb|3TT6|B Chain B, Structure Of Clpp From Bacillus Subtilis In Compressed
           State
 pdb|3TT6|C Chain C, Structure Of Clpp From Bacillus Subtilis In Compressed
           State
 pdb|3TT6|D Chain D, Structure Of Clpp From Bacillus Subtilis In Compressed
           State
 pdb|3TT6|E Chain E, Structure Of Clpp From Bacillus Subtilis In Compressed
           State
 pdb|3TT6|F Chain F, Structure Of Clpp From Bacillus Subtilis In Compressed
           State
 pdb|3TT6|G Chain G, Structure Of Clpp From Bacillus Subtilis In Compressed
           State
          Length = 196

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 47/70 (67%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQAT++EIA K I  ++ +L K+ A+  G+  E IE D  R  + S  EA
Sbjct: 120 MIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEA 179

Query: 61  VEYGIMDKVL 70
           +EYG++DK+L
Sbjct: 180 LEYGLIDKIL 189


>pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With
           Dfp
 pdb|3TT7|B Chain B, Structure Of Clpp From Bacillus Subtilis In Complex With
           Dfp
 pdb|3TT7|C Chain C, Structure Of Clpp From Bacillus Subtilis In Complex With
           Dfp
 pdb|3TT7|D Chain D, Structure Of Clpp From Bacillus Subtilis In Complex With
           Dfp
 pdb|3TT7|E Chain E, Structure Of Clpp From Bacillus Subtilis In Complex With
           Dfp
 pdb|3TT7|F Chain F, Structure Of Clpp From Bacillus Subtilis In Complex With
           Dfp
 pdb|3TT7|G Chain G, Structure Of Clpp From Bacillus Subtilis In Complex With
           Dfp
          Length = 197

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 47/70 (67%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQAT++EIA K I  ++ +L K+ A+  G+  E IE D  R  + S  EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEA 180

Query: 61  VEYGIMDKVL 70
           +EYG++DK+L
Sbjct: 181 LEYGLIDKIL 190


>pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic
           Crystal Form
 pdb|3KTG|B Chain B, Structure Of Clpp From Bacillus Subtilis In Monoclinic
           Crystal Form
 pdb|3KTG|C Chain C, Structure Of Clpp From Bacillus Subtilis In Monoclinic
           Crystal Form
 pdb|3KTG|D Chain D, Structure Of Clpp From Bacillus Subtilis In Monoclinic
           Crystal Form
 pdb|3KTG|E Chain E, Structure Of Clpp From Bacillus Subtilis In Monoclinic
           Crystal Form
 pdb|3KTG|F Chain F, Structure Of Clpp From Bacillus Subtilis In Monoclinic
           Crystal Form
 pdb|3KTG|G Chain G, Structure Of Clpp From Bacillus Subtilis In Monoclinic
           Crystal Form
 pdb|3KTH|A Chain A, Structure Of Clpp From Bacillus Subtilis In Orthorombic
           Crystal Form
 pdb|3KTH|B Chain B, Structure Of Clpp From Bacillus Subtilis In Orthorombic
           Crystal Form
 pdb|3KTH|C Chain C, Structure Of Clpp From Bacillus Subtilis In Orthorombic
           Crystal Form
 pdb|3KTH|D Chain D, Structure Of Clpp From Bacillus Subtilis In Orthorombic
           Crystal Form
 pdb|3KTH|E Chain E, Structure Of Clpp From Bacillus Subtilis In Orthorombic
           Crystal Form
 pdb|3KTH|F Chain F, Structure Of Clpp From Bacillus Subtilis In Orthorombic
           Crystal Form
 pdb|3KTH|G Chain G, Structure Of Clpp From Bacillus Subtilis In Orthorombic
           Crystal Form
          Length = 199

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 47/70 (67%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQAT++EIA K I  ++ +L K+ A+  G+  E IE D  R  + S  EA
Sbjct: 120 MIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQPLEVIERDTDRDNFKSAEEA 179

Query: 61  VEYGIMDKVL 70
           +EYG++DK+L
Sbjct: 180 LEYGLIDKIL 189


>pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|B Chain B, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|C Chain C, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|D Chain D, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|E Chain E, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|F Chain F, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|G Chain G, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|H Chain H, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|I Chain I, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|J Chain J, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|K Chain K, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|L Chain L, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|M Chain M, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
 pdb|2C8T|N Chain N, The 3.0 A Resolution Structure Of Caseinolytic Clp
           Protease 1 From Mycobacterium Tuberculosis
          Length = 206

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 46/70 (65%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           ++ QP+G + G A D+ I  ++   +K E+ +L A+  G+  E+IEAD  R ++F+ +EA
Sbjct: 122 LMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEA 181

Query: 61  VEYGIMDKVL 70
           +EYG +D ++
Sbjct: 182 LEYGFVDHII 191


>pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|B Chain B, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|C Chain C, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|D Chain D, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|E Chain E, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|F Chain F, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|G Chain G, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|H Chain H, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|I Chain I, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|J Chain J, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|K Chain K, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|L Chain L, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|M Chain M, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CE3|N Chain N, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
          Length = 200

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 46/70 (65%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           ++ QP+G + G A D+ I  ++   +K E+ +L A+  G+  E+IEAD  R ++F+ +EA
Sbjct: 121 LMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEA 180

Query: 61  VEYGIMDKVL 70
           +EYG +D ++
Sbjct: 181 LEYGFVDHII 190


>pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CBY|B Chain B, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CBY|C Chain C, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CBY|D Chain D, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CBY|E Chain E, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CBY|F Chain F, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
 pdb|2CBY|G Chain G, Crystal Structure Of The Atp-Dependent Clp Protease
           Proteolytic Subunit 1 (Clpp1) From Mycobacterium
           Tuberculosis
          Length = 208

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 46/70 (65%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           ++ QP+G + G A D+ I  ++   +K E+ +L A+  G+  E+IEAD  R ++F+ +EA
Sbjct: 121 LMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEA 180

Query: 61  VEYGIMDKVL 70
           +EYG +D ++
Sbjct: 181 LEYGFVDHII 190


>pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From
           Staphylococcus Aureus
 pdb|3ST9|B Chain B, Crystal Structure Of Clpp In Heptameric Form From
           Staphylococcus Aureus
 pdb|3ST9|C Chain C, Crystal Structure Of Clpp In Heptameric Form From
           Staphylococcus Aureus
 pdb|3ST9|D Chain D, Crystal Structure Of Clpp In Heptameric Form From
           Staphylococcus Aureus
 pdb|3ST9|E Chain E, Crystal Structure Of Clpp In Heptameric Form From
           Staphylococcus Aureus
 pdb|3ST9|F Chain F, Crystal Structure Of Clpp In Heptameric Form From
           Staphylococcus Aureus
 pdb|3ST9|G Chain G, Crystal Structure Of Clpp In Heptameric Form From
           Staphylococcus Aureus
 pdb|3STA|V Chain V, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|A Chain A, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|B Chain B, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|C Chain C, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|E Chain E, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|F Chain F, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|G Chain G, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|I Chain I, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|K Chain K, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|L Chain L, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|M Chain M, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|N Chain N, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|S Chain S, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
 pdb|3STA|T Chain T, Crystal Structure Of Clpp In Tetradecameric Form From
           Staphylococcus Aureus
          Length = 197

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 47/73 (64%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQAT++EIA   I   + +L ++ ++  G++ E+I+ D  R  + +  EA
Sbjct: 123 MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA 182

Query: 61  VEYGIMDKVLYTE 73
            EYG++D+V+  E
Sbjct: 183 KEYGLIDEVMVPE 195


>pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|B Chain B, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|C Chain C, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|D Chain D, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|E Chain E, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|F Chain F, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|G Chain G, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|H Chain H, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|I Chain I, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|J Chain J, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|K Chain K, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|L Chain L, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|M Chain M, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3QWD|N Chain N, Crystal Structure Of Clpp From Staphylococcus Aureus
 pdb|3V5E|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|B Chain B, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|C Chain C, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|D Chain D, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|E Chain E, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|F Chain F, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|G Chain G, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|H Chain H, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|I Chain I, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|J Chain J, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|K Chain K, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|L Chain L, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|M Chain M, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
 pdb|3V5E|N Chain N, Crystal Structure Of Clpp From Staphylococcus Aureus In
           The Active, Extended Conformation
          Length = 203

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 47/73 (64%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQAT++EIA   I   + +L ++ ++  G++ E+I+ D  R  + +  EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA 180

Query: 61  VEYGIMDKVLYTE 73
            EYG++D+V+  E
Sbjct: 181 KEYGLIDEVMVPE 193


>pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|B Chain B, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|C Chain C, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|D Chain D, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|E Chain E, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|F Chain F, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|G Chain G, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|H Chain H, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|I Chain I, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|J Chain J, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|K Chain K, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|L Chain L, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|M Chain M, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|N Chain N, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|O Chain O, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|P Chain P, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|Q Chain Q, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|R Chain R, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|S Chain S, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|T Chain T, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|U Chain U, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|V Chain V, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|W Chain W, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|X Chain X, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|Y Chain Y, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|Z Chain Z, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|AA Chain a, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
 pdb|3V5I|BB Chain b, The Crystal Structure Of The Mutant Clpp S98a
           (Staphylococcus Aureus)
          Length = 203

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 47/73 (64%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G  +GQAT++EIA   I   + +L ++ ++  G++ E+I+ D  R  + +  EA
Sbjct: 121 MIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEA 180

Query: 61  VEYGIMDKVLYTE 73
            EYG++D+V+  E
Sbjct: 181 KEYGLIDEVMVPE 193


>pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P
           From Francisella Tularensis
 pdb|3P2L|B Chain B, Crystal Structure Of Atp-Dependent Clp Protease Subunit P
           From Francisella Tularensis
 pdb|3P2L|C Chain C, Crystal Structure Of Atp-Dependent Clp Protease Subunit P
           From Francisella Tularensis
 pdb|3P2L|D Chain D, Crystal Structure Of Atp-Dependent Clp Protease Subunit P
           From Francisella Tularensis
 pdb|3P2L|E Chain E, Crystal Structure Of Atp-Dependent Clp Protease Subunit P
           From Francisella Tularensis
 pdb|3P2L|F Chain F, Crystal Structure Of Atp-Dependent Clp Protease Subunit P
           From Francisella Tularensis
 pdb|3P2L|G Chain G, Crystal Structure Of Atp-Dependent Clp Protease Subunit P
           From Francisella Tularensis
          Length = 201

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 38/69 (55%)

Query: 2   IKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAV 61
           I QP+G   GQA+D+EI  K I  +K  L K+ A H G+  E I  D  R  +    EA 
Sbjct: 125 IHQPLGGFRGQASDIEIHAKNILRIKDRLNKVLAHHTGQDLETIVKDTDRDNFXXADEAK 184

Query: 62  EYGIMDKVL 70
            YG++D V+
Sbjct: 185 AYGLIDHVI 193


>pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain
           From Plasmodium Falciparum
 pdb|2F6I|B Chain B, Crystal Structure Of The Clpp Protease Catalytic Domain
           From Plasmodium Falciparum
 pdb|2F6I|C Chain C, Crystal Structure Of The Clpp Protease Catalytic Domain
           From Plasmodium Falciparum
 pdb|2F6I|D Chain D, Crystal Structure Of The Clpp Protease Catalytic Domain
           From Plasmodium Falciparum
 pdb|2F6I|E Chain E, Crystal Structure Of The Clpp Protease Catalytic Domain
           From Plasmodium Falciparum
 pdb|2F6I|F Chain F, Crystal Structure Of The Clpp Protease Catalytic Domain
           From Plasmodium Falciparum
 pdb|2F6I|G Chain G, Crystal Structure Of The Clpp Protease Catalytic Domain
           From Plasmodium Falciparum
          Length = 215

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 40/73 (54%)

Query: 1   MIKQPIGRIEGQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEA 60
           MI QP+G   G   D+EI  KEI  +K  L    +    +T E IE D  R  Y +  EA
Sbjct: 132 MIHQPLGNAFGHPQDIEIQTKEILYLKKLLYHYLSSFTNQTVETIEKDSDRDYYMNALEA 191

Query: 61  VEYGIMDKVLYTE 73
            +YGI+D+V+ T+
Sbjct: 192 KQYGIIDEVIETK 204


>pdb|4HNK|A Chain A, Crystal Structure Of An Enzyme
 pdb|4HNK|B Chain B, Crystal Structure Of An Enzyme
 pdb|4HNK|C Chain C, Crystal Structure Of An Enzyme
 pdb|4HNK|D Chain D, Crystal Structure Of An Enzyme
 pdb|4HNK|E Chain E, Crystal Structure Of An Enzyme
 pdb|4HNK|F Chain F, Crystal Structure Of An Enzyme
 pdb|4HNK|G Chain G, Crystal Structure Of An Enzyme
 pdb|4HNK|H Chain H, Crystal Structure Of An Enzyme
 pdb|4HNK|I Chain I, Crystal Structure Of An Enzyme
 pdb|4HNK|J Chain J, Crystal Structure Of An Enzyme
 pdb|4HNK|K Chain K, Crystal Structure Of An Enzyme
 pdb|4HNK|L Chain L, Crystal Structure Of An Enzyme
 pdb|4HNK|M Chain M, Crystal Structure Of An Enzyme
 pdb|4HNK|N Chain N, Crystal Structure Of An Enzyme
          Length = 219

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 11  GQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIMDKVL 70
            QAT++EI  KEI N K +++++ +K+  K    I   + R KYF+  EAV++ ++D +L
Sbjct: 157 NQATNIEIQNKEIMNTKKKVIEIISKNTEKDTNVISNVLERDKYFNADEAVDFKLIDHIL 216


>pdb|4GM2|A Chain A, The Crystal Structure Of A Peptidase From Plasmodium
           Falciparum
 pdb|4GM2|B Chain B, The Crystal Structure Of A Peptidase From Plasmodium
           Falciparum
 pdb|4GM2|C Chain C, The Crystal Structure Of A Peptidase From Plasmodium
           Falciparum
 pdb|4GM2|D Chain D, The Crystal Structure Of A Peptidase From Plasmodium
           Falciparum
 pdb|4GM2|E Chain E, The Crystal Structure Of A Peptidase From Plasmodium
           Falciparum
 pdb|4GM2|F Chain F, The Crystal Structure Of A Peptidase From Plasmodium
           Falciparum
 pdb|4GM2|G Chain G, The Crystal Structure Of A Peptidase From Plasmodium
           Falciparum
          Length = 205

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 11  GQATDVEIARKEIKNVKAELVKLYAKHFGKTPEQIEADIRRPKYFSPSEAVEYGIMDKVL 70
            QAT++EI  KEI N K +++++ +K+  K    I   + R KYF+  EAV++ ++D +L
Sbjct: 143 NQATNIEIQNKEIMNTKKKVIEIISKNTEKDTNVISNVLERDKYFNADEAVDFKLIDHIL 202


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.134    0.365 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,643,758
Number of Sequences: 62578
Number of extensions: 94852
Number of successful extensions: 208
Number of sequences better than 100.0: 25
Number of HSP's better than 100.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 185
Number of HSP's gapped (non-prelim): 25
length of query: 91
length of database: 14,973,337
effective HSP length: 58
effective length of query: 33
effective length of database: 11,343,813
effective search space: 374345829
effective search space used: 374345829
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)