BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039269
         (439 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3FU1|A Chain A, Crystal Structure Of The Major Pseudopilin From The Type 2
           Secretion System Of Vibrio Cholerae
 pdb|3FU1|B Chain B, Crystal Structure Of The Major Pseudopilin From The Type 2
           Secretion System Of Vibrio Cholerae
          Length = 115

 Score = 29.3 bits (64), Expect = 4.4,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 4/52 (7%)

Query: 24  EPEYLRLDGHVRRLSTESVGSDLSSIRASEKSNFGVSNLFGDGSVNHPEGGE 75
           EP   R  G+++RL  +  G+D   +   +K    V  L  DG     EGGE
Sbjct: 53  EPRNYREGGYIKRLPKDPWGNDYQYLSPGDKGTIDVFTLGADGQ----EGGE 100


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.127    0.334 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,540,779
Number of Sequences: 62578
Number of extensions: 380031
Number of successful extensions: 1103
Number of sequences better than 100.0: 27
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 22
Number of HSP's that attempted gapping in prelim test: 1078
Number of HSP's gapped (non-prelim): 39
length of query: 439
length of database: 14,973,337
effective HSP length: 102
effective length of query: 337
effective length of database: 8,590,381
effective search space: 2894958397
effective search space used: 2894958397
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 53 (25.0 bits)