Citrus Sinensis ID: 039295

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MQFQQLRREETWGYYMMQGGSRSRSGGNMPREEPMEKVARVASESAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDHDPRGADIERVLMRLLANSSAVPVPIVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL
cccccccccccccEECccccccccccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccEEEEECcccccHHHHHHHHHHHcccccccccEEEEccEEEcccHHHHHHHHccccHHHHHHcccccc
***************************************RVASESAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDHDPRGADIERVLMRLLANSSAVPVPIVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQFQQLRREETWGYYMMQGGSRSRSGGNMPREEPMEKVARVASESAVVIFSVSSCCMCHAVKRLFCGMGVNPTVYELDHDPRGADIERVLMRLLANSSAVPVPIVFIGGKLIGAMDRVMASHINGTLVPLLKEAGALWL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutaredoxin-C7 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins (By similarity). Involved in flower development as a regulator of petal primorida initiation and further petal morphogenesis. May mediate post-translational modifications of target proteins required for normal petal organ initiation and morphogenesis. ROXY1/TGA protein interactions can occur in vivo and support their biological relevance in petal development. May be involved in the regulation of the floral regulator class C gene AG (AGAMOUS).probableQ96305
Glutaredoxin-C3 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.probableQ6K609

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CQ9, chain A
Confidence level:very confident
Coverage over the Query: 20-137
View the alignment between query and template
View the model in PyMOL