Citrus Sinensis ID: 039378


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600
WLSTSSSFVFYFTSSSSSFNSAMGGKMKDATLLSEPTNNNATTQQIESNKKKKNKKNKHKEIEAEEEEEQQNELNLKRKLEAIETANGAEKKNNKEKKEKRKQEKELEEIEISEQSHDDDDGGHKKKQKKKKNKEDRDKANGKESENGDDETISFFKEEDDGQVVVTGKDVKEAKYKALKSFTESKLPDDVLGCCKNFKNPSPIQSHAWPFLLNGRDFIGIAKTGSGKTIAFGVPAMMHVLSNRKGKAVGKRVNPLCLVLSPTRELADQIYDVLNDAGKPCGVKSVCVYGGTSKQPQITALRSGVDIVIGTPGRLIDLIEMNVCHLSEVSFVVLDEADRMLDMGFEEPVRFILSKISLARQMVMFSATWPIEVHKLAEEYMDPNPVKVVVGSEDLAANHDVMQIVEVLDDRSRDQRLLALLEKYHKSQRNRVLVFALYQLEADRLENMLRRSGWKVVAIHGKKAQHERTKSLSLFKEGTCPLMVATDVAARGLDIPDVEVVINYSFPLTTEDYVHRIGRTGRAGKKGVSHTFFTNHNKALAGELVNVLREARQVVPDALLKFGTHVKKKESKLYGAHFREISADAPKAKKITFNNSDDED
cccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccccccccccccccccccHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHccccccccccccccEEEEEcccHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHccccEEEEcccHHHHHHHccccccccccEEEccccccccccccHHHHHHHHccccccccEEEEcccccHHHHHHHHHHcccccEEEEEccccccccccEEEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccccccEEEEEHHccccccccccEEEEEccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccc
********VFYF***********************************************************************************************************************************************FKEEDDGQVVVTGKDVKEAKYKALKSFTESKLPDDVLGCCKNFKNPSPIQSHAWPFLLNGRDFIGIAKTGSGKTIAFGVPAMMHVLSNRKGKAVGKRVNPLCLVLSPTRELADQIYDVLNDAGKPCGVKSVCVYGGTSKQPQITALRSGVDIVIGTPGRLIDLIEMNVCHLSEVSFVVLDEADRMLDMGFEEPVRFILSKISLARQMVMFSATWPIEVHKLAEEYMDPNPVKVVVGSEDLAANHDVMQIVEVLDDRSRDQRLLALLEKYHKSQRNRVLVFALYQLEADRLENMLRRSGWKVVAIHGKKAQHERTKSLSLFKEGTCPLMVATDVAARGLDIPDVEVVINYSFPLTTEDYVHRIGRTGRAGKKGVSHTFFTNHNKALAGELVNVLREARQVVPDALLKFGTH***********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WLSTSSSFVFYFTSSSSSFNSAMGGKMKDATLLSEPTNNNATTQQIExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSHDDDDGGHKKKQKKKKNKEDRDKANGKESENGDDETISFFKEEDDGQVVVTGKDVKEAKYKALKSFTESKLPDDVLGCCKNFKNPSPIQSHAWPFLLNGRDFIGIAKTGSGKTIAFGVPAMMHVLSNRKGKAVGKRVNPLCLVLSPTRELADQIYDVLNDAGKPCGVKSVCVYGGTSKQPQITALRSGVDIVIGTPGRLIDLIEMNVCHLSEVSFVVLDEADRMLDMGFEEPVRFILSKISLARQMVMFSATWPIEVHKLAEEYMDPNPVKVVVGSEDLAANHDVMQIVEVLDDRSRDQRLLALLEKYHKSQRNRVLVFALYQLEADRLENMLRRSGWKVVAIHGKKAQHERTKSLSLFKEGTCPLMVATDVAARGLDIPDVEVVINYSFPLTTEDYVHRIGRTGRAGKKGVSHTFFTNHNKALAGELVNVLREARQVVPDALLKFGTHVKKKESKLYGAHFREISADAPKAKKITFNNSDDED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DEAD-box ATP-dependent RNA helicase 5 ATP-dependent RNA helicase required for 60S ribosomal subunit synthesis. Involved in efficient pre-rRNA processing, predominantly at site A3, which is necessary for the normal formation of 25S and 5.8S rRNAs.probableQ9C551
DEAD-box ATP-dependent RNA helicase 5 ATP-dependent RNA helicase required for 60S ribosomal subunit synthesis. Involved in efficient pre-rRNA processing, predominantly at site A3, which is necessary for the normal formation of 25S and 5.8S rRNAs.probableQ6YS30
ATP-dependent RNA helicase DBP3 ATP-dependent RNA helicase required for 60S ribosomal subunit synthesis. Involved in efficient pre-rRNA processing, predominantly at site A3, which is necessary for the normal formation of 25S and 5.8S rRNAs.probableQ6C9P3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.13RNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FE2, chain A
Confidence level:very confident
Coverage over the Query: 176-392
View the alignment between query and template
View the model in PyMOL
Template: 2I4I, chain A
Confidence level:very confident
Coverage over the Query: 176-566
View the alignment between query and template
View the model in PyMOL
Template: 4A4D, chain A
Confidence level:confident
Coverage over the Query: 154-381
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 47-120
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 47-120
View the alignment between query and template
View the model in PyMOL