Citrus Sinensis ID: 039384

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MHKSDDVQPLKINSLILPVPDVQEYCEDKLDGSQALKEKIDEDTIKKLVDVEKHMFMAVAPDPDITIRSSGETRPSNFLLWQTSNCSLYSPAALWLEEKKKRQF
ccccccccccCCcCEEEEHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHcEEccccccccccccccc
********PLKINSLILPVPDVQEYCEDKLDGSQALKEKIDEDTIKKLVDVEKHMFMAVAPDPDITIRSSGETRPSNFLLWQTSNCSLYSPAALWLEEKKKRQF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKSDDVQPLKINSLILPVPDVQEYCEDKLDGSQALKEKIDEDTIKKLVDVEKHMFMAVAPDPDITIRSSGETRPSNFLLWQTSNCSLYSPAALWLEEKKKRQF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dehydrodolichyl diphosphate synthase 6 Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein.probableQ8S2T1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F75, chain A
Confidence level:very confident
Coverage over the Query: 7-103
View the alignment between query and template
View the model in PyMOL