BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039432
(598 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2CJQ|A Chain A, Bovine Viral Diarrhea Virus Cp7-R12 Rna-Dependent Rna
Polymerase
Length = 720
Score = 32.0 bits (71), Expect = 0.98, Method: Compositional matrix adjust.
Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)
Query: 308 LPWYSVRQPQLLNSAVVNLIKQEWNFKEEPIMVVLDSQGMVTNSNALDMVLIWGARGYPF 367
+P Y + P L N + N +++EW+ EP+ V D++ T + D+ LI + Y +
Sbjct: 313 IPGYEGKTP-LFN--IFNKVRKEWDLFNEPVAVSFDTKNWDTQVTSRDLRLIGEIQKYYY 369
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.135 0.413
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,669,477
Number of Sequences: 62578
Number of extensions: 653622
Number of successful extensions: 1484
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1484
Number of HSP's gapped (non-prelim): 1
length of query: 598
length of database: 14,973,337
effective HSP length: 104
effective length of query: 494
effective length of database: 8,465,225
effective search space: 4181821150
effective search space used: 4181821150
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)