BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039446
         (146 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q6FB05|Y1930_ACIAD Maf-like protein ACIAD1930 OS=Acinetobacter sp. (strain ADP1)
          GN=ACIAD1930 PE=3 SV=1
          Length = 198

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 54 NLASICRAGFSQSRRSLSFNDRLGLQYCIVDRDPDE 89
          N++ I  A  SQ+R++L   DRLGL Y I+  D DE
Sbjct: 3  NISDIILASSSQTRKALM--DRLGLTYRIISPDIDE 36


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.134    0.387 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,454,980
Number of Sequences: 539616
Number of extensions: 1694767
Number of successful extensions: 3142
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 3142
Number of HSP's gapped (non-prelim): 3
length of query: 146
length of database: 191,569,459
effective HSP length: 106
effective length of query: 40
effective length of database: 134,370,163
effective search space: 5374806520
effective search space used: 5374806520
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)