BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039447
         (307 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2RGO|A Chain A, Structure Of Alpha-Glycerophosphate Oxidase From
           Streptococcus Sp.: A Template For The Mitochondrial
           Alpha- Glycerophosphate Dehydrogenase
 pdb|2RGO|B Chain B, Structure Of Alpha-Glycerophosphate Oxidase From
           Streptococcus Sp.: A Template For The Mitochondrial
           Alpha- Glycerophosphate Dehydrogenase
          Length = 607

 Score = 28.1 bits (61), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%)

Query: 153 PTKLHEKSTEATKSRTRSSLKEETATRTQKEHRTN 187
           PTKL E  TE  K    + L+EE AT     + TN
Sbjct: 473 PTKLEETVTELAKEGVAAGLEEEDATYIADFYGTN 507


>pdb|2RGH|A Chain A, Structure Of Alpha-Glycerophosphate Oxidase From
           Streptococcus Sp.: A Template For The Mitochondrial
           Alpha- Glycerophosphate Dehydrogenase
          Length = 571

 Score = 27.7 bits (60), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 18/35 (51%)

Query: 153 PTKLHEKSTEATKSRTRSSLKEETATRTQKEHRTN 187
           PTKL E  TE  K    + L+EE AT     + TN
Sbjct: 437 PTKLEETVTELAKEGVAAGLEEEDATYIADFYGTN 471


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.129    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,245,987
Number of Sequences: 62578
Number of extensions: 212716
Number of successful extensions: 371
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 369
Number of HSP's gapped (non-prelim): 3
length of query: 307
length of database: 14,973,337
effective HSP length: 99
effective length of query: 208
effective length of database: 8,778,115
effective search space: 1825847920
effective search space used: 1825847920
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)