BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039460
         (182 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3MC2|A Chain A, Crystal Structure Of The Murine Inhibitor Of Carbonic
           Anhydrase
 pdb|3MC2|B Chain B, Crystal Structure Of The Murine Inhibitor Of Carbonic
           Anhydrase
 pdb|3MC2|C Chain C, Crystal Structure Of The Murine Inhibitor Of Carbonic
           Anhydrase
 pdb|3MC2|D Chain D, Crystal Structure Of The Murine Inhibitor Of Carbonic
           Anhydrase
          Length = 687

 Score = 28.1 bits (61), Expect = 2.6,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 7   SALIQLKHFFNDNQRLQNWADAANDENYSNCCQWEAVEKATYECS 51
           SA   LK    D+QR++ W  A   +  + C QW AV      C+
Sbjct: 327 SAFRNLKRGLEDSQRVK-WC-AVGQQERTKCDQWSAVSGGALACA 369


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.137    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,236,747
Number of Sequences: 62578
Number of extensions: 132604
Number of successful extensions: 240
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 240
Number of HSP's gapped (non-prelim): 3
length of query: 182
length of database: 14,973,337
effective HSP length: 93
effective length of query: 89
effective length of database: 9,153,583
effective search space: 814668887
effective search space used: 814668887
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)