Citrus Sinensis ID: 039514

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790
AAAASSNITTDQQALLALKDHIISDPTNLLAHNWTSNASVCTWIGITCDVNSHRVTALDTSQFNLQGTIPSQLGNLSSLTILNLSHNKLSGSVPSSIYTMHTLKFLDFTDNQLSGSVSSFVFNMSSIVDIRLTNNRLSGELPKNICNYLPHLKALFLDKNMFHGKIPSALSKCKQLQQLNLQLNNLSGAIPKEIGNLTMLKGISLLYNKLQEALVLGMNNLVGVLPATIFNMSTLKVLILINNSLSGSLPSRIDLSLPTVEVLILALNRFFGTIPSSITNASKLTVLELGGNTFSGLIPDTIGNLRNLEWLNLSKNSLTSSTSKLSFLSSLANCKKLRSLKLAGNPLDGFLPSSIGNLSKSLETLVIANCSISGNIPQAISNLSNLLTLVLERNKLTGPISITFGRLQKLQGLYLASNNLVGSFPDELCHIGRLAELALLDNRHSGSIPSCVSNLTSLRYLYLGSNRFTFVIPSTFWSLKDILFFDFSSNFLVGTLSFDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQFMDLAYNRLEGPIPESFGDLTSLEVLNLSKNKISGSIPKSMEKLFYLRELNLSFNELEGEIPSGGIFANFTAESFMGNELLCGLPNLQVQPCKVSKPRTEHKSRKKILLIVIVLPLSIALTIAITLALKYKLIECGKRSTVLSNDSILSSQATLRRFSYLELLQATDNFAENNIIGRGGFGSVYGARLEDGMKIAIKVFHQQCASALKSFEAECEVLKKIRHRNLIKVISSCSNDDFKALVLEYMSNGSLGDWLHSSNY
ccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccEEEEEccccccEECccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEcccccccccccHHHcccccccccccccccccccEEccccccEEcccHHHHcccccccccccccccCCcccHHHHcccccccEEEcccccccccccHHHHHcccccEEEccccCEEECccccccccccccEEEccccccccccccccccccccccccccEEEcccccccccccHHHHccccccccEEccccEEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHccccccccEEccccCEECcccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHcccccccEEcccccccccccHHHHccccccEEccccccccccccHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccccEEEcccccEEEEEEcccccEEEEEEEccccccccHHHHHHHHHHHcccccccccEEEEEEcccccEEEEcccccccHHHHcccccc
**********DQQALLALKDHIISDPTNLLAHNWTSNASVCTWIGITCDVNSHRVTALDTSQFNLQGTIPSQLGNLSSLTILNLSHNKLSGSVPSSIYTMHTLKFLDFTDNQLSGSVSSFVFNMSSIVDIRLTNNRLSGELPKNICNYLPHLKALFLDKNMFHGKIPSALSKCKQLQQLNLQLNNLSGAIPKEIGNLTMLKGISLLYNKLQEALVLGMNNLVGVLPATIFNMSTLKVLILINNSLSGSLPSRIDLSLPTVEVLILALNRFFGTIPSSITNASKLTVLELGGNTFSGLIPDTIGNLRNLEWLNLSKNSLTSSTSKLSFLSSLANCKKLRSLKLAGNPLDGFLPSSIGNLSKSLETLVIANCSISGNIPQAISNLSNLLTLVLERNKLTGPISITFGRLQKLQGLYLASNNLVGSFPDELCHIGRLAELALLDNRHSGSIPSCVSNLTSLRYLYLGSNRFTFVIPSTFWSLKDILFFDFSSNFLVGTLSFDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQFMDLAYNRLEGPIPESFGDLTSLEVLNLSKNKISGSIPKSMEKLFYLRELNLSFNELEGEIPSGGIFANFTAESFMGNELLCGLPNLQVQPC************KKILLIVIVLPLSIALTIAITLALKYKLIECGKR************QATLRRFSYLELLQATDNFAENNIIGRGGFGSVYGARLEDGMKIAIKVFHQQCASALKSFEAECEVLKKIRHRNLIKVISSCSNDDFKALVLEYMSNGSLGDWLHS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AAAASSNITTDQQALLALKDHIISDPTNLLAHNWTSNASVCTWIGITCDVNSHRVTALDTSQFNLQGTIPSQLGNLSSLTILNLSHNKLSGSVPSSIYTMHTLKFLDFTDNQLSGSVSSFVFNMSSIVDIRLTNNRLSGELPKNICNYLPHLKALFLDKNMFHGKIPSALSKCKQLQQLNLQLNNLSGAIPKEIGNLTMLKGISLLYNKLQEALVLGMNNLVGVLPATIFNMSTLKVLILINNSLSGSLPSRIDLSLPTVEVLILALNRFFGTIPSSITNASKLTVLELGGNTFSGLIPDTIGNLRNLEWLNLSKNSLTSSTSKLSFLSSLANCKKLRSLKLAGNPLDGFLPSSIGNLSKSLETLVIANCSISGNIPQAISNLSNLLTLVLERNKLTGPISITFGRLQKLQGLYLASNNLVGSFPDELCHIGRLAELALLDNRHSGSIPSCVSNLTSLRYLYLGSNRFTFVIPSTFWSLKDILFFDFSSNFLVGTLSFDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQFMDLAYNRLEGPIPESFGDLTSLEVLNLSKNKISGSIPKSMEKLFYLRELNLSFNELEGEIPSGGIFANFTAESFMGNELLCGLPNLQVQPCKVSKPRTEHKSRKKILLIVIVLPLSIALTIAITLALKYKLIECGKRSTVLSNDSILSSQATLRRFSYLELLQATDNFAENNIIGRGGFGSVYGARLEDGMKIAIKVFHQQCASALKSFEAECEVLKKIRHRNLIKVISSCSNDDFKALVLEYMSNGSLGDWLHSSNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IFG, chain A
Confidence level:very confident
Coverage over the Query: 41-49,62-164
View the alignment between query and template
View the model in PyMOL
Template: 2IFG, chain A
Confidence level:very confident
Coverage over the Query: 500-590
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 53-617
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 6-190,226-320
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 683-788
View the alignment between query and template
View the model in PyMOL
Template: 3RIZ, chain A
Confidence level:confident
Coverage over the Query: 30-305,335-621
View the alignment between query and template
View the model in PyMOL
Template: 3CD3, chain A
Confidence level:probable
Coverage over the Query: 661-781
View the alignment between query and template
View the model in PyMOL