BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039534
(380 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3UGV|A Chain A, Crystal Structure Of An Enolase From Alpha Pretobacterium
Bal199 (Efi Target Efi-501650) With Bound Mg
pdb|3UGV|B Chain B, Crystal Structure Of An Enolase From Alpha Pretobacterium
Bal199 (Efi Target Efi-501650) With Bound Mg
pdb|3UGV|C Chain C, Crystal Structure Of An Enolase From Alpha Pretobacterium
Bal199 (Efi Target Efi-501650) With Bound Mg
pdb|3UGV|D Chain D, Crystal Structure Of An Enolase From Alpha Pretobacterium
Bal199 (Efi Target Efi-501650) With Bound Mg
pdb|3UGV|E Chain E, Crystal Structure Of An Enolase From Alpha Pretobacterium
Bal199 (Efi Target Efi-501650) With Bound Mg
pdb|3UGV|F Chain F, Crystal Structure Of An Enolase From Alpha Pretobacterium
Bal199 (Efi Target Efi-501650) With Bound Mg
pdb|3UGV|G Chain G, Crystal Structure Of An Enolase From Alpha Pretobacterium
Bal199 (Efi Target Efi-501650) With Bound Mg
pdb|3UGV|H Chain H, Crystal Structure Of An Enolase From Alpha Pretobacterium
Bal199 (Efi Target Efi-501650) With Bound Mg
Length = 390
Score = 28.9 bits (63), Expect = 5.0, Method: Compositional matrix adjust.
Identities = 12/34 (35%), Positives = 23/34 (67%)
Query: 129 FVGHLGSVELAAVGVSVSVFNLVSKLFNVPLLNI 162
FVG+ G +AA GV ++V++ +++ N+PL +
Sbjct: 117 FVGYAGLSMIAASGVDMAVWDALARAANMPLCTL 150
>pdb|3F5B|A Chain A, The Crystal Structure Of Aminoglycoside
N(6')acetyltransferase From Legionella Pneumophila
Subsp. Pneumophila Str. Philadelphia 1
Length = 182
Score = 27.7 bits (60), Expect = 9.6, Method: Compositional matrix adjust.
Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
Query: 321 KLSD-NVLLMSPDIDGRRVVH-YLKSGGLLIGRTIA 354
+ SD ++L++P+I R VH Y K+G +IG IA
Sbjct: 123 QFSDTKIVLINPEISNERAVHVYKKAGFEIIGEFIA 158
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.137 0.399
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,845,271
Number of Sequences: 62578
Number of extensions: 234975
Number of successful extensions: 509
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 508
Number of HSP's gapped (non-prelim): 2
length of query: 380
length of database: 14,973,337
effective HSP length: 101
effective length of query: 279
effective length of database: 8,652,959
effective search space: 2414175561
effective search space used: 2414175561
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)