Citrus Sinensis ID: 039549


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
FQSPTFIEWLKPSSSSSSSSSYSSYVTQQAQLTNPMMTILKFPPVYQQQKQQQQPENLDEGVRCLPLLSRFKEKKALKEEEEDMQVQETNLGVKQEKIEKVTVALHIGLPNTGDSDAESKDFDTKQEEMISRKSFHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGHSPHPSLDGFEDEKECVTTGSEDEVARSC
cccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccHHHHHHcccccccccccccccccccHHHHHHccccccccccccccccccccccccHHHHHccccc
ccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccHHcccccccccccccEEEEEccccEEEccccEEEEccccccccHHHHHHHHccccccccccccccccccccHHccccEEEccccccccccccccccHHHHHHHHHHHHHccccccccEccccccEEEEccHHHHHcccccEEEEccccccccHHHHHHHHHHHccccccccccccccHHccccccccHccccccc
fqsptfiewlkpsssssssssyssYVTQQaqltnpmmtilkfppvyqqqkqqqqpenldegvrclplLSRFKEKKALKEEEEDMQVQETNLGVKQEKIEKVTVALHIglpntgdsdaeskdfdtkQEEMisrksfhgcslnkdsrfwiptpaqilvgpmQFACSICSKTFNRYNNMqmhmwghgseyrkgpdslkgtqpaamlrlpcyccaqgcknninhprakplkdfRTLQTHFkrkhgakpfmcrkcgktfavkgdwrthekncgklwyctcgsdfkhkrSLKDHIrsfgkghsphpsldgfedekecvttgsedevarsc
fqsptfiewlkpsssssssssySSYVTQQAQLTNPMMTILKFPPVYQQQKQQQQPENLDEGVRCLPLLSRFKEKKalkeeeedmqvqetnlgvkqekiEKVTVALHIglpntgdsdaeskDFDTKQEEMISRKSFHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCAQGCKNninhprakpLKDFRTLQTHFkrkhgakpfmcrkcgktfavkgdwrthekncgklWYCTCGSDFKHKRSLKDHIRSFGKghsphpsldgfedekecvttgsedevarsc
FQSPTFIEWLKPsssssssssyssyVTQQAQLTNPMMTILKFPPVYqqqkqqqqPENLDEGVRCLPLLSRFkekkalkeeeeDMQVQETNLGVKQEKIEKVTVALHIGLPNTGDSDAESKDFDTKQEEMISRKSFHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGHSPHPSLDGFEDEKECVTTGSEDEVARSC
**************************************************************************************************EKVTVALHIG**************************FHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGS*************PAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKH*******************************************
**SPTFI******************************************************V****************EEEEDMQVQETNLGVKQEKIEKVTVALHI************************RKSFHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGHSPHPSLDGFE******************
FQSPTFIE*******************QQAQLTNPMMTILKFPPV************LDEGVRCLPLLSRFKEKKA**********QETNLGVKQEKIEKVTVALHIGLPNTGD**************MISRKSFHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGHSPHPSLD*********************
**SPTFIEWLKPS*********************************************DEGVR***********************************EKVTVALHIGLPN***************************SLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKG***L**TQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGHSPHPSLDG********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FQSPTFIEWLKPSSSSSSSSSYSSYVTQQAQLTNPMMTILKFPPVYQQQKQQQQPENLDEGVRCLPLLSRFKEKKAxxxxxxxxxxxxxxxxxxxxxIEKVTVALHIGLPNTGDSDAESKDFDTKQEEMISRKSFHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGHSPHPSLDGFEDEKECVTTGSEDEVARSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query324 2.2.26 [Sep-21-2011]
Q8VWG3303 Protein TRANSPARENT TESTA no no 0.663 0.709 0.611 2e-77
Q9C8N5499 Protein SENSITIVE TO PROT no no 0.450 0.292 0.392 4e-24
Q943I6522 Zinc finger protein STOP1 no no 0.484 0.300 0.369 5e-23
Q2QX40465 Zinc finger protein STAR3 no no 0.441 0.307 0.388 4e-20
Q700D2 503 Zinc finger protein JACKD no no 0.401 0.258 0.352 3e-17
Q9ZWA6 506 Zinc finger protein MAGPI no no 0.419 0.268 0.349 2e-16
Q9FFH3 466 Zinc finger protein NUTCR no no 0.398 0.276 0.352 2e-16
Q6P9S1 818 ATM interactor OS=Mus mus yes no 0.25 0.099 0.336 9e-10
O43313 823 ATM interactor OS=Homo sa yes no 0.25 0.098 0.326 3e-09
Q8BXX2 756 Zinc finger and BTB domai no no 0.348 0.149 0.298 4e-08
>sp|Q8VWG3|TT1_ARATH Protein TRANSPARENT TESTA 1 OS=Arabidopsis thaliana GN=TT1 PE=2 SV=1 Back     alignment and function desciption
 Score =  289 bits (740), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 163/219 (74%), Gaps = 4/219 (1%)

Query: 101 VTVALHIGLPNTGDSDAESKDFDTKQEEMISRKSFHGCSLNKDS--RFWIPTPAQILVGP 158
           V V LHIGLP  G    ++K    +  + I+         N+ S   +WIP P QIL+G 
Sbjct: 83  VDVDLHIGLPGFGKPSNDAKQLKKRNGKEIATYDAGKGIENELSGKAYWIPAPEQILIGF 142

Query: 159 MQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCAQGCKNNI 218
             F+C +C KTFNRYNN+QMHMWGHGS+YRKGP+SLKGTQP AML +PCYCC +GC+N+I
Sbjct: 143 THFSCHVCFKTFNRYNNLQMHMWGHGSQYRKGPESLKGTQPRAMLGIPCYCCVEGCRNHI 202

Query: 219 NHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSD 278
           +HPR+KPLKDFRTLQTH+KRKHG KPF CR CGK  AVKGDWRTHEKNCGK W C CGSD
Sbjct: 203 DHPRSKPLKDFRTLQTHYKRKHGHKPFSCRLCGKLLAVKGDWRTHEKNCGKRWVCVCGSD 262

Query: 279 FKHKRSLKDHIRSFGKGHSPHPSLDGFEDEKECVTTGSE 317
           FKHKRSLKDH+++FG GH P+P+  G  +E+   ++ SE
Sbjct: 263 FKHKRSLKDHVKAFGSGHGPYPT--GLFEEQASNSSVSE 299




May act as a transcriptional regulator involved in the differentiation of young endothelium. Altered differentiation results in incompetence for pigments synthesis and the lack of condensed tannins in the seed coat.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C8N5|STOP1_ARATH Protein SENSITIVE TO PROTON RHIZOTOXICITY 1 OS=Arabidopsis thaliana GN=STOP1 PE=2 SV=1 Back     alignment and function description
>sp|Q943I6|STOP1_ORYSJ Zinc finger protein STOP1 homolog OS=Oryza sativa subsp. japonica GN=Os01g0871200 PE=2 SV=1 Back     alignment and function description
>sp|Q2QX40|ART1_ORYSJ Zinc finger protein STAR3 OS=Oryza sativa subsp. japonica GN=STAR3 PE=2 SV=1 Back     alignment and function description
>sp|Q700D2|JKD_ARATH Zinc finger protein JACKDAW OS=Arabidopsis thaliana GN=JKD PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWA6|MGP_ARATH Zinc finger protein MAGPIE OS=Arabidopsis thaliana GN=MGP PE=1 SV=1 Back     alignment and function description
>sp|Q9FFH3|NUC_ARATH Zinc finger protein NUTCRACKER OS=Arabidopsis thaliana GN=NUC PE=2 SV=1 Back     alignment and function description
>sp|Q6P9S1|ATMIN_MOUSE ATM interactor OS=Mus musculus GN=Atmin PE=2 SV=2 Back     alignment and function description
>sp|O43313|ATMIN_HUMAN ATM interactor OS=Homo sapiens GN=ATMIN PE=1 SV=2 Back     alignment and function description
>sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
224078549333 predicted protein [Populus trichocarpa] 0.966 0.939 0.776 1e-137
225464978347 PREDICTED: protein TRANSPARENT TESTA 1 [ 0.969 0.904 0.723 1e-135
255565597343 TRANSPARENT TESTA 1 protein, putative [R 0.962 0.909 0.755 1e-132
359807510323 uncharacterized protein LOC100802773 [Gl 0.919 0.922 0.667 1e-121
356539268330 PREDICTED: protein TRANSPARENT TESTA 1-l 0.925 0.909 0.666 1e-119
356542013321 PREDICTED: protein TRANSPARENT TESTA 1-l 0.904 0.912 0.675 1e-116
356547134319 PREDICTED: protein TRANSPARENT TESTA 1-l 0.907 0.921 0.681 1e-114
357453039309 Protein TRANSPARENT TESTA [Medicago trun 0.888 0.932 0.650 1e-112
224105069207 predicted protein [Populus trichocarpa] 0.638 1.0 0.884 1e-108
449443626308 PREDICTED: protein TRANSPARENT TESTA 1-l 0.879 0.925 0.618 1e-102
>gi|224078549|ref|XP_002305556.1| predicted protein [Populus trichocarpa] gi|222848520|gb|EEE86067.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 253/326 (77%), Positives = 283/326 (86%), Gaps = 13/326 (3%)

Query: 1   FQSPTFIEWLKPSSSSSSSSSYSSY----VTQQAQLTNPMMTILKFPPVYQQQKQQQQPE 56
           FQ+P FIEWLKPSSS S SSS SS     VTQQ QLTNPM ++L+ P ++ QQ Q QQ E
Sbjct: 15  FQAPNFIEWLKPSSSPSPSSSSSSLSNSSVTQQVQLTNPM-SVLRLPSLFPQQ-QHQQRE 72

Query: 57  NLDEGVRCLPLLSRFKEKKALKEEEEDMQVQETNLGVKQEKIEKVTVALHIGLPNTGDSD 116
            + E ++CLPLLSRF EKK LK+   DM+V+E+ +GVK+EK  +VTVALHIGLPN+GDS+
Sbjct: 73  AMKETIQCLPLLSRFTEKKTLKDG--DMEVKESTVGVKEEK--EVTVALHIGLPNSGDSE 128

Query: 117 AESKDFDTKQEEMISRKSFHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNM 176
            E++  D K EE+  +K+F G S N +SRFWIPTPAQILVGPMQFACSICSKTFNRYNNM
Sbjct: 129 VETEVLDLK-EEISMKKNFQGYSFNSESRFWIPTPAQILVGPMQFACSICSKTFNRYNNM 187

Query: 177 QMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHF 236
           QMHMWGHGSE+RKGPDSLKGTQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTH+
Sbjct: 188 QMHMWGHGSEFRKGPDSLKGTQPAAMLRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHY 247

Query: 237 KRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGH 296
           KRKHGAKPFMCRKC KTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGH
Sbjct: 248 KRKHGAKPFMCRKCSKTFAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLKDHIRSFGKGH 307

Query: 297 SPHPSLDGFED-EKECVTTGSEDEVA 321
           SPHPSL+GFE+ +KEC+ TGSEDE A
Sbjct: 308 SPHPSLEGFEEIDKECI-TGSEDEFA 332




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225464978|ref|XP_002277045.1| PREDICTED: protein TRANSPARENT TESTA 1 [Vitis vinifera] gi|147767982|emb|CAN64917.1| hypothetical protein VITISV_027337 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565597|ref|XP_002523788.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis] gi|223536876|gb|EEF38514.1| TRANSPARENT TESTA 1 protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359807510|ref|NP_001241401.1| uncharacterized protein LOC100802773 [Glycine max] gi|255639739|gb|ACU20163.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356539268|ref|XP_003538121.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356542013|ref|XP_003539466.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356547134|ref|XP_003541972.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357453039|ref|XP_003596796.1| Protein TRANSPARENT TESTA [Medicago truncatula] gi|355485844|gb|AES67047.1| Protein TRANSPARENT TESTA [Medicago truncatula] Back     alignment and taxonomy information
>gi|224105069|ref|XP_002313674.1| predicted protein [Populus trichocarpa] gi|222850082|gb|EEE87629.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443626|ref|XP_004139578.1| PREDICTED: protein TRANSPARENT TESTA 1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query324
TAIR|locus:2200003337 WIP3 "AT1G08290" [Arabidopsis 0.929 0.893 0.560 3e-92
TAIR|locus:2076641383 NTT "AT3G57670" [Arabidopsis t 0.533 0.451 0.761 3.1e-85
TAIR|locus:2091931412 WIP4 "AT3G20880" [Arabidopsis 0.503 0.395 0.791 2.2e-84
TAIR|locus:2008281337 WIP5 "AT1G51220" [Arabidopsis 0.598 0.575 0.676 3.1e-83
TAIR|locus:2205334302 DOT5 "DEFECTIVELY ORGANIZED TR 0.635 0.682 0.642 6.2e-78
TAIR|locus:2008386303 TT1 "transparent testa 1" [Ara 0.774 0.828 0.544 2.1e-77
TAIR|locus:2036303499 STOP1 "AT1G34370" [Arabidopsis 0.484 0.314 0.383 1.1e-28
UNIPROTKB|Q943I6522 LOC_Os01g65080 "Zinc finger pr 0.456 0.283 0.376 2.5e-25
TAIR|locus:2172701373 AT5G22890 [Arabidopsis thalian 0.648 0.563 0.330 3.6e-25
UNIPROTKB|Q2QX40465 STAR3 "Zinc finger protein STA 0.435 0.303 0.402 1.8e-24
TAIR|locus:2200003 WIP3 "AT1G08290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 919 (328.6 bits), Expect = 3.0e-92, P = 3.0e-92
 Identities = 190/339 (56%), Positives = 222/339 (65%)

Query:     1 FQSPTFIEWLKPXXXXXXXXXXXXXVTQQAQLTNPMMTILKFPPVYXXXXXXXXPENLDE 60
             F+SP+FIEWLKP                +  ++       +   +          E L+ 
Sbjct:    11 FESPSFIEWLKPQSSTTSSKSVLYRGKTRDAISRSNHHQSQMNMLERSLFLYQPQEPLNT 70

Query:    61 GVRCLPLLSRFXXXXXXXXXXXDMQVQETNLGVKQEKIEKVTVALHIGLP--NTGDS-DA 117
              ++CLPLL++             M+       +K+E  + V V L IG P  + G S D 
Sbjct:    71 SIQCLPLLNKL------------MENNSQASDIKEENKDDV-VTLQIGFPKYHRGSSEDG 117

Query:   118 ESKDFDTKQE----EMIS---------RK-SFHGCSLNKD-----SRFWIPTPAQILVGP 158
                 FD +++    E+I          RK  F    ++ D      RFWIP+PAQI VGP
Sbjct:   118 SDITFDHQKKPIKREIIEDGVVMMKKRRKMKFDEEIIDSDVEVCGKRFWIPSPAQIHVGP 177

Query:   159 MQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGT-QPAAMLRLPCYCCAQGCKNN 217
             MQFACSICSKTFNRYNNMQMHMWGHGSE+RKG DSLKGT QPAA+LRLPCYCCA+GCKNN
Sbjct:   178 MQFACSICSKTFNRYNNMQMHMWGHGSEFRKGADSLKGTIQPAAILRLPCYCCAEGCKNN 237

Query:   218 INHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCTCGS 277
             INHPR+KPLKDFRTLQTH+KRKHG+KPF C KCGK  AVKGDWRTHEKNCGKLWYCTCGS
Sbjct:   238 INHPRSKPLKDFRTLQTHYKRKHGSKPFSCGKCGKALAVKGDWRTHEKNCGKLWYCTCGS 297

Query:   278 DFKHKRSLKDHIRSFGKGHSPHPSL--DGFEDEKECVTT 314
             DFKHKRSLKDHIRSFG GHSPHPSL  DGFE++ ECVTT
Sbjct:   298 DFKHKRSLKDHIRSFGSGHSPHPSLLFDGFEEDTECVTT 336




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2076641 NTT "AT3G57670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091931 WIP4 "AT3G20880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008281 WIP5 "AT1G51220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205334 DOT5 "DEFECTIVELY ORGANIZED TRIBUTARIES 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008386 TT1 "transparent testa 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036303 STOP1 "AT1G34370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q943I6 LOC_Os01g65080 "Zinc finger protein STOP1 homolog" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2172701 AT5G22890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q2QX40 STAR3 "Zinc finger protein STAR3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037377001
SubName- Full=Chromosome undetermined scaffold_87, whole genome shotgun sequence; (281 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 324
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.96
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.87
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.84
KOG3576267 consensus Ovo and related transcription factors [T 99.76
KOG3608467 consensus Zn finger proteins [General function pre 99.73
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.71
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.58
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.54
KOG3576267 consensus Ovo and related transcription factors [T 99.53
KOG3608467 consensus Zn finger proteins [General function pre 99.49
PLN03086567 PRLI-interacting factor K; Provisional 99.31
PHA00733128 hypothetical protein 99.25
smart00431113 SCAN leucine rich region. 99.16
PHA0276855 hypothetical protein; Provisional 99.08
cd0793685 SCAN SCAN oligomerization domain. The SCAN domain 99.05
PHA00733128 hypothetical protein 98.97
PF0202395 SCAN: SCAN domain; InterPro: IPR003309 A number of 98.96
PLN03086567 PRLI-interacting factor K; Provisional 98.94
PHA0276855 hypothetical protein; Provisional 98.91
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.91
KOG3993500 consensus Transcription factor (contains Zn finger 98.9
KOG3993500 consensus Transcription factor (contains Zn finger 98.52
PHA0073279 hypothetical protein 98.5
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.27
PHA0061644 hypothetical protein 98.17
PHA0073279 hypothetical protein 98.09
PHA0061644 hypothetical protein 98.07
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.82
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.71
COG5189423 SFP1 Putative transcriptional repressor regulating 97.69
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.64
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.62
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.54
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.49
COG5189423 SFP1 Putative transcriptional repressor regulating 97.47
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.36
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.33
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.2
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.19
PRK04860160 hypothetical protein; Provisional 96.75
smart0035526 ZnF_C2H2 zinc finger. 96.59
smart0035526 ZnF_C2H2 zinc finger. 96.45
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 96.38
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.09
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.06
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.02
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.85
COG5048467 FOG: Zn-finger [General function prediction only] 95.85
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.75
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.4
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.19
KOG1146 1406 consensus Homeobox protein [General function predi 94.49
PRK04860160 hypothetical protein; Provisional 94.43
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.39
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.03
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.15
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.95
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.7
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.67
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.41
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 90.42
KOG1146 1406 consensus Homeobox protein [General function predi 90.3
COG5048467 FOG: Zn-finger [General function prediction only] 89.97
KOG2785 390 consensus C2H2-type Zn-finger protein [General fun 88.56
KOG2231 669 consensus Predicted E3 ubiquitin ligase [Posttrans 87.42
KOG2893 341 consensus Zn finger protein [General function pred 86.93
KOG2893 341 consensus Zn finger protein [General function pred 85.78
KOG2186 276 consensus Cell growth-regulating nucleolar protein 85.37
COG404965 Uncharacterized protein containing archaeal-type C 84.83
COG404965 Uncharacterized protein containing archaeal-type C 84.04
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 83.07
KOG4377480 consensus Zn-finger protein [General function pred 81.57
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 81.54
KOG4173253 consensus Alpha-SNAP protein [Intracellular traffi 81.31
KOG2186 276 consensus Cell growth-regulating nucleolar protein 80.12
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.96  E-value=6.8e-31  Score=224.78  Aligned_cols=134  Identities=28%  Similarity=0.512  Sum_probs=125.9

Q ss_pred             ccCccccCCCCCCCCCCCCcchhhhhhcC---CCceeccccchhccChhHHHHhHhhhCCCCcCCCCCCCCCCCCccCcc
Q 039549          129 MISRKSFHGCSLNKDSRFWIPTPAQILVG---PMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRL  205 (324)
Q Consensus       129 ~~~~~~c~~C~~~~~~~~~l~~H~~~h~~---~~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~~~~~~~~~~~~~~~~~  205 (324)
                      ...++.|..|++.+.+...|.+|.+.|..   .+.+.|++|||.|.....|..|+|+|+                  .++
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~------------------l~c  188 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT------------------LPC  188 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC------------------CCc
Confidence            44578999999999999999999999964   678999999999999999999999997                  568


Q ss_pred             cCCCCCCCCccCcCCCCCccCCChhHHHHHHhhhcCCCceecccccceecchHHHHHHHHhc--CCeeeec-CCcccCCh
Q 039549          206 PCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNC--GKLWYCT-CGSDFKHK  282 (324)
Q Consensus       206 ~C~~C~~~~~~~~~~~~~k~f~~~~~L~~H~r~H~gekp~~C~~Cgk~F~~~~~L~~H~~~~--~k~~~C~-Cgk~F~~~  282 (324)
                      .|.+||            |.|.+.--|+.|+|+|||||||.|..|+|+|..+++|+.|++||  .|+|+|. |+|+|..+
T Consensus       189 ~C~iCG------------KaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~  256 (279)
T KOG2462|consen  189 ECGICG------------KAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALK  256 (279)
T ss_pred             cccccc------------ccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHH
Confidence            999999            99999999999999999999999999999999999999999987  5999998 99999999


Q ss_pred             hHHHHHHHhh
Q 039549          283 RSLKDHIRSF  292 (324)
Q Consensus       283 ~~L~~H~r~~  292 (324)
                      +.|++|...-
T Consensus       257 SyLnKH~ES~  266 (279)
T KOG2462|consen  257 SYLNKHSESA  266 (279)
T ss_pred             HHHHHhhhhc
Confidence            9999998763



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>smart00431 SCAN leucine rich region Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>cd07936 SCAN SCAN oligomerization domain Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF02023 SCAN: SCAN domain; InterPro: IPR003309 A number of C2H2-zinc finger proteins contain a highly conserved N-terminal motif termed the SCAN domain Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4377 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 36/143 (25%), Positives = 59/143 (41%), Gaps = 31/143 (21%) Query: 152 AQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCA 211 A + G +AC C K+F+R +++ H H G +P Y C Sbjct: 13 AALEPGEKPYACPECGKSFSRSDHLAEHQRTH-----------TGEKP--------YKCP 53 Query: 212 QGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEK-NCGKL 270 + K D + L H + G KP+ C +CGK+F+ + + R H++ + G+ Sbjct: 54 EC---------GKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEK 104 Query: 271 WYC--TCGSDFKHKRSLKDHIRS 291 Y CG F L+ H R+ Sbjct: 105 PYACPECGKSFSQLAHLRAHQRT 127

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query324
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-04
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
 Score = 45.2 bits (108), Expect = 9e-07
 Identities = 16/66 (24%), Positives = 24/66 (36%), Gaps = 7/66 (10%)

Query: 231 TLQTHFKRKH-GAKPFMCRKCGKTFAVKGDWRTHEKN----CGKLWYCT-CGSDFKHKRS 284
           +  +   R H G KP+ C  C   F   G  + H           ++C  C +    K  
Sbjct: 2   SSGSS-GRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSD 60

Query: 285 LKDHIR 290
           L  H+R
Sbjct: 61  LGVHLR 66


>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.86
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.85
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.79
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.78
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.76
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.75
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.74
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.72
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.71
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.67
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.67
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.65
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.65
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.65
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.65
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.63
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.61
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.58
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.58
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.58
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.56
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.55
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.55
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.55
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.54
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.53
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.51
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.51
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.51
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.51
2fi2_A94 Zinc finger protein 42; SCAN domain, ZNF-42, MZF-1 99.49
1y7q_A98 AW-1, zinc finger protein 174; SCAN domain, retrov 99.49
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.48
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.48
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.47
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.46
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.43
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.41
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.4
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
3lhr_A93 Zinc finger protein 24; SCAN domain, protein struc 99.37
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.37
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.36
4e6s_A93 Zinc finger and SCAN domain-containing protein 10; 99.36
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.35
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.34
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.34
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.34
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.33
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.33
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.31
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.21
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.18
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.16
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.14
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.14
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.14
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.1
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.07
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.03
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.02
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.01
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.0
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.0
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.98
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.98
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.97
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.96
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.96
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.94
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.94
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.94
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.93
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.92
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.92
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.9
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.86
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.86
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.85
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.85
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.84
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.83
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.83
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.83
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.82
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.8
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.75
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.74
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.7
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.68
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.66
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.55
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.51
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.51
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.49
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.49
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.46
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.46
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.37
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.34
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.34
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.26
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.26
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.25
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.25
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.24
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.22
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.21
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.18
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.18
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.17
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.15
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.14
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.13
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.13
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.12
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.11
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.1
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.09
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.09
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.08
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.07
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.32
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.05
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.31
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.02
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.0
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.0
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.0
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.99
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.99
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.22
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.97
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.95
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.17
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.94
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.94
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.85
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.85
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.06
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.81
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.79
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.78
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.97
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.73
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.4
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.03
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 96.76
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.23
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.66
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.4
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.94
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.46
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 90.4
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.89
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 88.62
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 88.24
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 85.45
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 81.27
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=1.3e-29  Score=214.59  Aligned_cols=139  Identities=24%  Similarity=0.556  Sum_probs=110.2

Q ss_pred             ccccCCCCCCCCCCCCcchhhhhhcCCCceeccccchhccChhHHHHhHhhhCCCCcCCCCCCCCCCCCccCcccCCCCC
Q 039549          132 RKSFHGCSLNKDSRFWIPTPAQILVGPMQFACSICSKTFNRYNNMQMHMWGHGSEYRKGPDSLKGTQPAAMLRLPCYCCA  211 (324)
Q Consensus       132 ~~~c~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~~~~~~~~~~~~~~~~~~C~~C~  211 (324)
                      .+.|..|++.|.....|..|++.|.+.++|.|+.|++.|.....|..|++.|.++                ++|.|..|+
T Consensus        49 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~----------------~~~~C~~C~  112 (190)
T 2i13_A           49 PYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGE----------------KPYACPECG  112 (190)
T ss_dssp             CEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHTC----------------CCEECTTTC
T ss_pred             CccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHHhcCCC----------------CCCcCCCCC
Confidence            4567777777777777777777777777777777777777777777777777666                667777777


Q ss_pred             CCCccCcCCCCCccCCChhHHHHHHhhhcCCCceecccccceecchHHHHHHHHh--cCCeeeec-CCcccCChhHHHHH
Q 039549          212 QGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKN--CGKLWYCT-CGSDFKHKRSLKDH  288 (324)
Q Consensus       212 ~~~~~~~~~~~~k~f~~~~~L~~H~r~H~gekp~~C~~Cgk~F~~~~~L~~H~~~--~~k~~~C~-Cgk~F~~~~~L~~H  288 (324)
                                  +.|.+...|..|+++|++++||.|.+||+.|.....|..|+++  +++||.|. |++.|..+..|.+|
T Consensus       113 ------------~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H  180 (190)
T 2i13_A          113 ------------KSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVH  180 (190)
T ss_dssp             ------------CEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHH
T ss_pred             ------------CccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHH
Confidence                        9999999999999999999999999999999999999999985  47999998 99999999999999


Q ss_pred             HHhhCCCCCCC
Q 039549          289 IRSFGKGHSPH  299 (324)
Q Consensus       289 ~r~~h~~~~~~  299 (324)
                      +++|+ |++||
T Consensus       181 ~~~H~-~~k~~  190 (190)
T 2i13_A          181 QRTHT-GKKTS  190 (190)
T ss_dssp             HTTC-------
T ss_pred             HHhcC-CCCCC
Confidence            99875 66664



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2fi2_A Zinc finger protein 42; SCAN domain, ZNF-42, MZF-1, homodimer, transcription factor, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.28.3.2 Back     alignment and structure
>1y7q_A AW-1, zinc finger protein 174; SCAN domain, retroviral capsid C-terminal domain, dimer, C2H2 zinc finger associated, transcription; NMR {Homo sapiens} SCOP: a.28.3.2 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3lhr_A Zinc finger protein 24; SCAN domain, protein structure initiative, center for eukary structural genomics, PSI-2, CESG, nucleus, phosphoprotein; 1.90A {Homo sapiens} SCOP: a.28.3.0 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4e6s_A Zinc finger and SCAN domain-containing protein 10; protein interaction, other scans, N-terminal PA finger transcription factor, transcription; 1.85A {Mus musculus} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 324
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.004
d1x6ha137 g.37.1.1 (A:44-80) Transcriptional repressor CTCF 0.004
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 38.1 bits (88), Expect = 6e-05
 Identities = 16/51 (31%), Positives = 21/51 (41%), Gaps = 4/51 (7%)

Query: 243 KPFMCRKCGKTFAVKGDWRTHEKNCGKLWYCT---CGSDFKHKRSLKDHIR 290
           K + C +CGK+F  K     H      L       CG  FK K  L  H++
Sbjct: 2   KLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK 51


>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query324
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.62
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.61
d1y7qa196 Zinc finger protein 174 {Human (Homo sapiens) [Tax 99.34
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.28
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.25
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.25
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.21
d2fi2a192 Zinc finger protein 42 {Human (Homo sapiens) [TaxI 99.2
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.18
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.14
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.1
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.06
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.06
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.05
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.02
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.97
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.97
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.95
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.91
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.91
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.89
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.88
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.85
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.85
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.85
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.81
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.7
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.67
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.66
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.64
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.54
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.53
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.52
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.51
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.5
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.5
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.47
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.47
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.42
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.34
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.31
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.26
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.22
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.04
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.9
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.82
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.76
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.7
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.57
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.54
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.48
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.42
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.39
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.39
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.36
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.35
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.35
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.33
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.31
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.26
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.25
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.19
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.16
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.12
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.04
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.02
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.01
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.0
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.9
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.71
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.62
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.56
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.55
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.52
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.48
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.43
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.41
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.37
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.37
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.25
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.15
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.76
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.66
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.53
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.49
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.33
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.21
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.19
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.63
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.62
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.53
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.48
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.37
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.72
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.24
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.8
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.77
d1y0jb136 U-shaped transcription factor, different fingers { 92.19
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.68
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.17
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.27
d1x3ca161 Zinc finger protein 292, ZNF292 {Human (Homo sapie 89.1
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.09
d1y0jb136 U-shaped transcription factor, different fingers { 88.12
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 87.75
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.36
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 87.34
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.25
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.16
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.49
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.47
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 85.72
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 85.27
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 84.37
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 83.43
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 83.32
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 82.91
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.62  E-value=1.4e-16  Score=103.99  Aligned_cols=52  Identities=29%  Similarity=0.561  Sum_probs=40.9

Q ss_pred             CcccCCCCCCCCccCcCCCCCccCCChhHHHHHHhhhcCCCceecccccceecchHHHHHHHHhc
Q 039549          203 LRLPCYCCAQGCKNNINHPRAKPLKDFRTLQTHFKRKHGAKPFMCRKCGKTFAVKGDWRTHEKNC  267 (324)
Q Consensus       203 ~~~~C~~C~~~~~~~~~~~~~k~f~~~~~L~~H~r~H~gekp~~C~~Cgk~F~~~~~L~~H~~~~  267 (324)
                      |||.| .||            +.|....+|..|+++|+|++||.|.+||++|.+.+.|..|+++|
T Consensus         2 K~y~C-~Cg------------k~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPC-QCG------------KSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEEC-TTS------------CEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCC-CCC------------CeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            67778 487            77888888888888888888888888888888888888887754



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7qa1 a.28.3.2 (A:37-132) Zinc finger protein 174 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fi2a1 a.28.3.2 (A:37-128) Zinc finger protein 42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ca1 g.37.1.1 (A:8-68) Zinc finger protein 292, ZNF292 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure