Citrus Sinensis ID: 039578

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MVKFLKPNKVVILLQGRYAGRKVVISRVEAFVKLVNYQHLMPTRYTLNIDLKEVLTADSLQSKDKKVTACKETKKRLEERFKTGKNCWFFTKLGF
ccccccccCEEEEEccEEcccEEEEEEEcEEEEEEEccccccCEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccccCEEEEcccc
**KFLKPNKVVILLQGRYAGRKVVISRVEAFVKLVNYQHLMPTRYTLNIDLKEVLTADSLQSKDK*VT*CKETKKRLEERFKTGKNCWFFTKLGF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKFLKPNKVVILLQGRYAGRKVVISRVEAFVKLVNYQHLMPTRYTLNIDLKEVLTADSxxxxxxxxxxxxxxxxxxxxxFKTGKNCWFFTKLGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L27-2 probableQ8LCL3
60S ribosomal protein L27-3 probableP51419

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A18, chain N
Confidence level:very confident
Coverage over the Query: 2-95
View the alignment between query and template
View the model in PyMOL