BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039589
         (296 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3S6K|A Chain A, Crystal Structure Of Xcnags
          Length = 467

 Score = 31.2 bits (69), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 33  PQKFANVHKVFGASNVAKLLNELATN-LREDAVNSLAYEAEARLRDPVYGCVG 84
           P   A V KVF ASN+ KL+  L  N  R  ++    +EAE   RD  YG VG
Sbjct: 126 PHALAIVRKVFQASNL-KLVEALQQNGARATSITGGVFEAEYLNRD-TYGLVG 176


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.131    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,566,976
Number of Sequences: 62578
Number of extensions: 199695
Number of successful extensions: 327
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 327
Number of HSP's gapped (non-prelim): 1
length of query: 296
length of database: 14,973,337
effective HSP length: 98
effective length of query: 198
effective length of database: 8,840,693
effective search space: 1750457214
effective search space used: 1750457214
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)