BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039643
         (520 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2P1M|B Chain B, Tir1-ask1 Complex Structure
 pdb|2P1N|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1N|E Chain E, Mechanism Of Auxin Perception By The Tir1 Ubiqutin Ligase
 pdb|2P1O|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
 pdb|2P1P|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
 pdb|2P1Q|B Chain B, Mechanism Of Auxin Perception By The Tir1 Ubiquitin Ligase
 pdb|3C6N|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein-
           Substrate Interactions In Auxin Perception And Signaling
 pdb|3C6O|B Chain B, Small Molecule Agonists And Antagonists Of F-Box
           Protein-Substrate Interactions In Auxin Perception And
           Signaling
 pdb|3C6P|B Chain B, Small Molecule Agonists And Antagonists Of F-Box Protein-
           Substrate Interactions In Auxin Perception And Signaling
          Length = 594

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 229 VVATCPNLKKLHLSEIVLEDQEFHELISKFPLLEDLSVSSSQPLERVKFSSNLLKRVAFL 288
           +V  CPNLK L L+  V   ++   L+ + P LE+L         R    S L   VA  
Sbjct: 206 LVTRCPNLKSLKLNRAV-PLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGL--SVALS 262

Query: 289 FCRSLRAV 296
            C+ LR +
Sbjct: 263 GCKELRCL 270


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.137    0.413 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 14,636,757
Number of Sequences: 62578
Number of extensions: 589823
Number of successful extensions: 1297
Number of sequences better than 100.0: 21
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 21
Number of HSP's that attempted gapping in prelim test: 1294
Number of HSP's gapped (non-prelim): 22
length of query: 520
length of database: 14,973,337
effective HSP length: 103
effective length of query: 417
effective length of database: 8,527,803
effective search space: 3556093851
effective search space used: 3556093851
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)