Citrus Sinensis ID: 039651


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
MALEHIDDSEVDIVIAALQSDLTSFLNAWRPLFSRFHLIIVQDPDLKGELKIPQGFDHRVYTKSDIDQVIGPTTSIVFSGYSCRYFGYLVSRKKYIISVDDDCLPAKDNDGNLTNAVSQHLANLTTPATPFFFNTLYDPFREGADFVRGYPFSLRSGVDCALSCGLWLNLADYDAPTQALKPEHRNLHYVDAVMTVPAGTLMPISGINIAFNRALVGPALFPGLKLTGEGKLRWETIEDIWCGMCVKVICDHLSIGVKTGLPYVFRSDKGNPIESLKKEWEGVKKMEEIIPFFQSVRLPRTATTAEDCLLEMAKSVKDRLGGTDPLFARAAEAMVEWVKIWKAAGASHSTPGV
ccccccccccEEEEEEEccccHHHHHHHHHcccccEEEEEEEccccccccccccccccEEECcccccccccccccccccccHHHHHHHHHccccEEEEEcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccECccccccccccHHHHccccccccccccccEEEEcccccccccccHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHHHHHcHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccc
*******DSEVDIVIAALQSDLTSFLNAWRPLFSRFHLIIVQDPDLKGELKIPQGFDHRVYTKSDIDQVIGPTTSIVFSGYSCRYFGYLVSRKKYIISVDDDCLPAKDNDGNLTNAVSQHLANLTTPATPFFFNTLYDPFREGADFVRGYPFSLRSGVDCALSCGLWLNLADYDAPTQALKPEHRNLHYVDAVMTVPAGTLMPISGINIAFNRALVGPALFPGLKLTGEGKLRWETIEDIWCGMCVKVICDHLSIGVKTGLPYVFRSDKGNPIESLKKEWEGVKKMEEIIPFFQSVRLPRTATTAEDCLLEMAKSVKDRLGGTDPLFARAAEAMVEWVKIWKAA*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALEHIDDSEVDIVIAALQSDLTSFLNAWRPLFSRFHLIIVQDPDLKGELKIPQGFDHRVYTKSDIDQVIGPTTSIVFSGYSCRYFGYLVSRKKYIISVDDDCLPAKDNDGNLTNAVSQHLANLTTPATPFFFNTLYDPFREGADFVRGYPFSLRSGVDCALSCGLWLNLADYDAPTQALKPEHRNLHYVDAVMTVPAGTLMPISGINIAFNRALVGPALFPGLKLTGEGKLRWETIEDIWCGMCVKVICDHLSIGVKTGLPYVFRSDKGNPIESLKKEWEGVKKMEEIIPFFQSVRLPRTATTAEDCLLEMAKSVKDRLGGTDPLFARAAEAMVEWVKIWKAAGASHSTPGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable UDP-arabinopyranose mutase 2 Probable UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides (By similarity). Inactive in vitro, but could be active when associated with other proteins.probableQ7FAY6
Probable UDP-arabinopyranose mutase 5 Probable UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides (By similarity). Inactive in vitro, but could be active when associated with other proteins.probableQ9FFD2
Alpha-1,4-glucan-protein synthase [UDP-forming] 1 Possible role in the synthesis of cell wall polysaccharides.probableQ9SC19

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BCV, chain A
Confidence level:probable
Coverage over the Query: 10-108
View the alignment between query and template
View the model in PyMOL