BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039663
         (102 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q04581|TGB1_SHVX Movement and silencing protein TGBp1 OS=Shallot virus X GN=ORF2
           PE=3 SV=1
          Length = 241

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 14  RSEGHCSKVKFEMQGVEFE---VDFHILDFSGANAGLAVQWLEKLGK--IVTD 61
           +S G CSK+  E+QG+EFE   + +H  +F     G  +     LG+  ++TD
Sbjct: 176 QSHGVCSKLPSEVQGLEFEEVTLVYHSSEFERNRVGFYIAATRALGRLNLITD 228


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.322    0.137    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,541,347
Number of Sequences: 539616
Number of extensions: 1368298
Number of successful extensions: 2742
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 2742
Number of HSP's gapped (non-prelim): 2
length of query: 102
length of database: 191,569,459
effective HSP length: 71
effective length of query: 31
effective length of database: 153,256,723
effective search space: 4750958413
effective search space used: 4750958413
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)