Citrus Sinensis ID: 039685

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-

MDPEGKNFGRGPRELTGAVDLISHYKLLPHHDFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTSRDTSARIQPFDLDVLREAFQLRETSPVDLPPVRNPIP

ccccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHcccccCEEEccccccHHHHHHccccccccccccccHHHHHHHHHccccccccccccccccc

************RELTGAVDLISHYKLLPHHDFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQN*****SARIQPFDLDVLREAFQLRETSPVDL********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDPEGKNFGRGPRELTGAVDLISHYKLLPHHDFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTSRDTSARIQPFDLDVLREAFQLRETSPVDLPPVRNPIP

Annotation	Function Description	Confidence Level	Reference Protein
Probable mediator of RNA polymerase II transcription subunit 19b	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.	probable	Q6NQD9

No EC number assigned to the protein, probably not an enzyme!

No confident structure templates for the query are predicted