BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039801
         (466 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HYL|A Chain A, Crystal Structure Of Transketolase From Bacillus Anthracis
 pdb|3HYL|B Chain B, Crystal Structure Of Transketolase From Bacillus Anthracis
 pdb|3M49|A Chain A, Crystal Structure Of Transketolase Complexed With Thiamine
           Diphosphate From Bacillus Anthracis
 pdb|3M49|B Chain B, Crystal Structure Of Transketolase Complexed With Thiamine
           Diphosphate From Bacillus Anthracis
          Length = 690

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 49  FDQDDDDL--FSIKGSKTHGDPRARQRAVMEALVAKLFAGV-TSIKAAYAELQMAQNPYN 105
           +D   DDL  F   GSKT G P     A ++A    L  G+ T++  A AE  +A   YN
Sbjct: 106 YDVTXDDLKNFRQWGSKTPGHPEYGHTAGVDATTGPLGQGIATAVGXAXAERHLAAK-YN 164

Query: 106 SEAIHLADQ 114
            +A ++ D 
Sbjct: 165 RDAYNIVDH 173


>pdb|4F52|E Chain E, Structure Of A Glomulin-Rbx1-Cul1 Complex
 pdb|4F52|F Chain F, Structure Of A Glomulin-Rbx1-Cul1 Complex
          Length = 596

 Score = 28.9 bits (63), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 33/64 (51%)

Query: 73  RAVMEALVAKLFAGVTSIKAAYAELQMAQNPYNSEAIHLADQAVVDELKAISELKRSFLK 132
           + V++ L  K ++   ++   + +L +   PY+ E I + D  +    KA+ E  + F++
Sbjct: 132 QTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVE 191

Query: 133 KELD 136
           + +D
Sbjct: 192 EVID 195


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.131    0.366 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,006,801
Number of Sequences: 62578
Number of extensions: 445664
Number of successful extensions: 1079
Number of sequences better than 100.0: 22
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 18
Number of HSP's that attempted gapping in prelim test: 1072
Number of HSP's gapped (non-prelim): 24
length of query: 466
length of database: 14,973,337
effective HSP length: 102
effective length of query: 364
effective length of database: 8,590,381
effective search space: 3126898684
effective search space used: 3126898684
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)