Citrus Sinensis ID: 039838

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------

MLSDHLHSTLYETLKFLFLILVTAIEAFLIHQRFKPICHFFYFTCLAIILLLQFYLSKPSVTYLVDFSCYKPPCFCRVPFSSFLENSSLVETFDSESMAFMSKVLTCSGQSEETYLPPALQYIPPKTNQQESIKEAQMVLFPVIENLLSKVQISPQDIDILIINCSGFCPSPSLSSIIINKYSMKSDIKNFNLSGMGCSASALAIDMAQALLKTQKDSDALVLSTEILSTGWYSGNEKPKLLLNCLFRMGSVAVLLTNKKQAKRSSKYKVVRTVRTNKAFDDKAYNSGMREEDSNGKLGVTLNRDLLQIAGETLRANITILGFKILPFRELFWLGVSVIKKGFIKNSCDVYVPNFKAAVQHFCLPVSGRPVIREIAKNLKLGERDIEAALMTLHRFGNQSSSSLWYELAYMEAKERVKKGDRVWLIGAGTGSKCGSVVLQCLRPIVGESNKGPWAGCVEEYPVMNS

ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccCEEEEEEECccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEECccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccccHHHHHcccccccEEEEEEccccccccccccEEEEEEEcccccccccccccEEECccccEEEEEcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccHHccccEEEEccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHccccccccccccccccccccccccc

MLSDHLHSTLYETLKFLFLILVTAIEAFLIHQRFKPICHFFYFTCLAIILLLQFYLSKPSVTYLVDFSCYKPPCFCRVPFSSFLENSSLVETFDSESMAFMSKVLTCSGQSEETYLPPALQYIPPKTNQQESIKEAQMVLFPVIENLLSKVQISPQDIDILIINCSGFCPSPSLSSIIINKYSMKSDIKNFNLSGMGCSASALAIDMAQALLKTQKDSDALVLSTEILSTGWYSGNEKPKLLLNCLFRMGSVAVLLTNKKQA**SSKYKVVRTVRTNKAFDDKAYNSGMREEDSNGKLGVTLNRDLLQIAGETLRANITILGFKILPFRELFWLGVSVIKKGFIKNSCDVYVPNFKAAVQHFCLPVSGRPVIREIAKNLKLGERDIEAALMTLHRFGNQSSSSLWYELAYMEAKERVKKGDRVWLIGAGTGSKCGSVVLQCLRPIVGESNKGPWAGCVEEYPVM**

xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
3-ketoacyl-CoA synthase 5	Mediates mostly the synthesis of VLCFAs from 26 to 30 carbons in length (e.g. C20:1, C26, C28, C30).	probable	Q9C6L5

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U0M, chain A
Confidence level:very confident
Coverage over the Query: 62-311,334-444
View the alignment between query and template
View the model in PyMOL

Template: 3E1H, chain A
Confidence level:very confident
Coverage over the Query: 58-318,341-444
View the alignment between query and template
View the model in PyMOL

Template: 1QLV, chain A
Confidence level:probable
Coverage over the Query: 168-334,364-445
View the alignment between query and template
View the model in PyMOL