BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039843
         (348 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1OLX|B Chain B, Roles Of His291-alpha And His146-beta' In The Reductive
           Acylation Reaction Catalyzed By Human Branched-chain
           Alpha-ketoacid Dehydrogenase
          Length = 342

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 214 EMQLSDFKFLIFGFYTTLLERIIN-PLKYGFKEADIACCGSGIYRGPNCGIGEFELCSNP 272
           E+Q +D+ F  F       ++I+N   KY ++  D+  CGS   R P   +G   L ++ 
Sbjct: 96  EIQFADYIFPAF-------DQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYASQ 148

Query: 273 NEYLFFDGHHP 283
           +   FF  H P
Sbjct: 149 SPEAFF-AHCP 158


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.142    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,140,758
Number of Sequences: 62578
Number of extensions: 491891
Number of successful extensions: 945
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 944
Number of HSP's gapped (non-prelim): 2
length of query: 348
length of database: 14,973,337
effective HSP length: 100
effective length of query: 248
effective length of database: 8,715,537
effective search space: 2161453176
effective search space used: 2161453176
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)