BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039853
         (206 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3PP9|A Chain A, 1.6 Angstrom Resolution Crystal Structure Of Putative
           Streptothricin Acetyltransferase From Bacillus Anthracis
           Str. Ames In Complex With Acetyl Coenzyme A
 pdb|3PP9|B Chain B, 1.6 Angstrom Resolution Crystal Structure Of Putative
           Streptothricin Acetyltransferase From Bacillus Anthracis
           Str. Ames In Complex With Acetyl Coenzyme A
 pdb|3PP9|C Chain C, 1.6 Angstrom Resolution Crystal Structure Of Putative
           Streptothricin Acetyltransferase From Bacillus Anthracis
           Str. Ames In Complex With Acetyl Coenzyme A
          Length = 187

 Score = 28.5 bits (62), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/52 (23%), Positives = 30/52 (57%)

Query: 147 VASRRKVIVTTRNQGVTSIMGTMPAYELKKLVNDSCRLIFSQHPSGTREIVY 198
           V +R  + ++  N+ +   +  +P+YE   L ND+  L+++++ +   +I+Y
Sbjct: 28  VNARLXLSLSKVNRRIEYTVEDVPSYEKSYLQNDNEELVYNEYINKPNQIIY 79


>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In
           Its Inward- Facing Conformation
          Length = 587

 Score = 26.6 bits (57), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 9/53 (16%)

Query: 62  SVTPVIGMGGSGNTTLALPVYNDKTVNSIHNTISPETASASDDNLNSLQVKLK 114
           S+  V+G  GSG +TL         +N I   I PE      D L+   VKLK
Sbjct: 370 SLVAVLGETGSGKSTL---------MNLIPRLIDPERGRVEVDELDVRTVKLK 413


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.130    0.362 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,558,751
Number of Sequences: 62578
Number of extensions: 212004
Number of successful extensions: 637
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 636
Number of HSP's gapped (non-prelim): 4
length of query: 206
length of database: 14,973,337
effective HSP length: 94
effective length of query: 112
effective length of database: 9,091,005
effective search space: 1018192560
effective search space used: 1018192560
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)