Query 039893
Match_columns 68
No_of_seqs 108 out of 261
Neff 3.9
Searched_HMMs 46136
Date Fri Mar 29 03:05:41 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/039893.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/039893hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF01439 Metallothio_2: Metall 99.9 7.5E-26 1.6E-30 141.8 5.1 61 1-65 1-74 (74)
2 PF02068 Metallothio_PEC: Plan 92.9 0.045 9.7E-07 34.8 0.8 17 51-67 34-50 (76)
3 PF02067 Metallothio_5: Metall 74.1 2.6 5.6E-05 24.1 1.6 16 4-19 16-32 (41)
4 KOG4738 Predicted metallothion 54.0 11 0.00023 22.3 1.7 16 50-65 9-24 (51)
5 PF00131 Metallothio: Metallot 53.1 11 0.00023 23.2 1.7 17 50-66 10-26 (63)
6 PF12749 Metallothio_Euk: Euka 46.9 12 0.00025 23.8 1.1 7 57-63 41-47 (74)
7 PF05033 Pre-SET: Pre-SET moti 44.4 14 0.0003 22.5 1.2 9 11-19 58-66 (103)
8 PF05522 Metallothio_6: Metall 41.0 13 0.00027 23.1 0.6 12 7-18 43-54 (65)
9 PF03638 TCR: Tesmin/TSO1-like 16.8 85 0.0018 17.6 1.1 11 53-63 26-36 (42)
10 COG4104 Uncharacterized conser 16.7 1.8E+02 0.0038 19.2 2.8 41 11-56 45-85 (98)
No 1
>PF01439 Metallothio_2: Metallothionein; InterPro: IPR000347 Members of this family are metallothioneins. These proteins are cysteine rich proteins that bind to heavy metals. Members of this family appear to be closest to Class II metallothioneins.; GO: 0046872 metal ion binding
Probab=99.92 E-value=7.5e-26 Score=141.78 Aligned_cols=61 Identities=38% Similarity=0.918 Sum_probs=51.4
Q ss_pred CCCCCC-CCCCCCCCcccCCCCccccceEeeeccceEEEEEEEee-----------ccc-CCCCCCCCCCccCCCCCC
Q 039893 1 MSDTCG-NCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQ-----------AAE-AEGNCKCGPTCACVNCTC 65 (68)
Q Consensus 1 MS~~CG-nC~Cg~~c~Cgk~g~~y~~di~e~e~s~~~t~~v~gv~-----------aaE-~~ggCKCG~nC~C~pC~C 65 (68)
||+.|| ||+|||+|||++ +|| |||.|+++++++| ||+||+ +++ ..++||||+||+||||||
T Consensus 1 MsC~CggnCgCGs~C~Cg~--kmy-pdl~~~~~ttt~t-~V~GVAP~k~~~eg~E~~~~~~~~GCKCGsnC~CdPCnC 74 (74)
T PF01439_consen 1 MSCGCGGNCGCGSGCKCGS--KMY-PDLEESETTTTET-LVLGVAPQKGHFEGSEMGAGAGGNGCKCGSNCTCDPCNC 74 (74)
T ss_pred CCCcCCCcCCCCCCCCcCC--ccc-cchhcccccccee-EEEeeCCCcchhhhhhhhhcccCCCCCCCCCCccCCCcC
Confidence 896588 999999999995 469 9998887788899 999994 111 345899999999999998
No 2
>PF02068 Metallothio_PEC: Plant PEC family metallothionein; InterPro: IPR000316 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, nickel, etc. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , , ]. An empirical classification into three classes has been proposed by Fowler and coworkers [] and Kojima []. Members of class I are defined to include polypeptides related in the positions of their cysteines to equine MT-1B, and include mammalian MTs as well as MTs from crustaceans and molluscs. Class II groups MTs from a variety of species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units []. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. This system subdivides the MT superfamily into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects []: e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. The inclusion of a MT within a family presupposes that its amino acid sequence is alignable with that of all members. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range: e.g., Family 1: vertebrate MTs. Family 15 consists of planta MTs. Its members are recognised by the sequence pattern [YFH]-x(5,25)-C-[SKD]-C-[GA]-[SDPAT]-x(0,1)-C-x-[CYF] which yields all plant sequences, but also MTCU_HELPO and the non-MT ITB3_HUMAN. The taxonomic range of the members extends to planta. Planta MTs are 45-84 residue proteins, containing 17 conserved cysteines that bind 5 zinc ions. Generally, there are two Cys-rich regions (domain 1 and domain 3) separated by a Cys-poor region (domain 2) and only the domain 2 contains unusual residues. It is believed that the proteins may have a role in Zn2+ homeostasis during embryogenesis. Family 15 includes the following subfamilies: p1, p2, p2v, p3, pec, p21. ; GO: 0008270 zinc ion binding; PDB: 2L62_A 2KAK_A 2L61_A.
Probab=92.90 E-value=0.045 Score=34.84 Aligned_cols=17 Identities=47% Similarity=1.445 Sum_probs=9.9
Q ss_pred CCCCCCCccCCCCCCCC
Q 039893 51 NCKCGPTCACVNCTCGS 67 (68)
Q Consensus 51 gCKCG~nC~C~pC~C~~ 67 (68)
.|.||-.|.||||+|.+
T Consensus 34 ~C~CGEhCgCnPCtC~k 50 (76)
T PF02068_consen 34 TCSCGEHCGCNPCTCPK 50 (76)
T ss_dssp -BTTTB--TTS--TT--
T ss_pred cccCCCcccccCccCCC
Confidence 69999999999999976
No 3
>PF02067 Metallothio_5: Metallothionein family 5; InterPro: IPR000966 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, and nickel. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, , ] species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class I MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. Diptera (Drosophila, family 5) MTs are 40-43 residue proteins that contain 10 conserved cysteines arranged in five Cys-X-Cys groups. In particular, the consensus pattern C-G-x(2)-C-x-C-x(2)-Q-x(5)-C-x-C-x(2)-D-C-x-C has been found to be diagnostic of family 5 MTs. The protein is found primarily in the alimentary canal, and its induction is stimulated by ingestion of cadmium or copper []. Mercury, silver and zinc induce the protein to a lesser extent. Family 5 includes subfamilies: d1, d2. Only one d2 is known until now. Subfamilies hit the same entry.; GO: 0046872 metal ion binding
Probab=74.10 E-value=2.6 Score=24.08 Aligned_cols=16 Identities=50% Similarity=1.288 Sum_probs=12.7
Q ss_pred CCC-CCCCCCCCcccCC
Q 039893 4 TCG-NCDCADRSQCVKK 19 (68)
Q Consensus 4 ~CG-nC~Cg~~c~Cgk~ 19 (68)
.|| ||.|...|+|+-+
T Consensus 16 kcg~~C~C~~dC~C~ck 32 (41)
T PF02067_consen 16 KCGGNCACNQDCKCVCK 32 (41)
T ss_pred ccCCCccCCCCcccccC
Confidence 577 8888888888855
No 4
>KOG4738 consensus Predicted metallothionein [Inorganic ion transport and metabolism]
Probab=53.97 E-value=11 Score=22.30 Aligned_cols=16 Identities=50% Similarity=1.788 Sum_probs=11.3
Q ss_pred CCCCCCCCccCCCCCC
Q 039893 50 GNCKCGPTCACVNCTC 65 (68)
Q Consensus 50 ggCKCG~nC~C~pC~C 65 (68)
+.|.||++|+|..+.|
T Consensus 9 ~~C~Cgs~CkC~~~kC 24 (51)
T KOG4738|consen 9 GSCTCGSSCKCSDCKC 24 (51)
T ss_pred CccccCCccccCCCcc
Confidence 3588888888866644
No 5
>PF00131 Metallothio: Metallothionein; InterPro: IPR003019 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, nickel, etc. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, ]. An empirical classification into three classes has been proposed by Fowler and coworkers [] and Kojima []. Members of class I are defined to include polypeptides related in the positions of their cysteines to equine MT-1B, and include mammalian MTs as well as from crustaceans and molluscs. Class II groups MTs from a variety of species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units []. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. This system subdivides the MT superfamily into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects []: e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. The inclusion of a MT within a family presupposes that its amino acid sequence is alignable with that of all members. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range: e.g., Family 1: vertebrate MTs [see http://www.bioc.unizh.ch/mtpage/protali.html]. This entry is a superfamily of metallothioneins, containing 3 families. All members are from eukaryotes.; GO: 0046872 metal ion binding; PDB: 1DMD_A 1DME_A 1DMF_A 1DMC_A 1J5L_A 1J5M_A 2MRT_A 4MT2_A 1MRT_A 2FJ4_A ....
Probab=53.12 E-value=11 Score=23.16 Aligned_cols=17 Identities=41% Similarity=1.464 Sum_probs=10.4
Q ss_pred CCCCCCCCccCCCCCCC
Q 039893 50 GNCKCGPTCACVNCTCG 66 (68)
Q Consensus 50 ggCKCG~nC~C~pC~C~ 66 (68)
+.|.|+++|+|..|.|.
T Consensus 10 gsC~C~~sCkc~~CkC~ 26 (63)
T PF00131_consen 10 GSCTCAGSCKCKECKCT 26 (63)
T ss_dssp SS---TSSSSSSSSSCT
T ss_pred CceecCCCccCCCccCC
Confidence 45888888888888774
No 6
>PF12749 Metallothio_Euk: Eukaryotic metallothionein; InterPro: IPR024306 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, nickel, etc. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, ]. An empirical classification into three classes has been proposed by Fowler and coworkers [] and Kojima []. Members of class I are defined to include polypeptides related in the positions of their cysteines to equine MT-1B, and include mammalian MTs as well as from crustaceans and molluscs. Class II groups MTs from a variety of species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units []. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. This system subdivides the MT superfamily into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects []: e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. The inclusion of a MT within a family presupposes that its amino acid sequence is alignable with that of all members. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range: e.g., Family 1: vertebrate MTs [see http://www.bioc.unizh.ch/mtpage/protali.html]. This entry represents a subgroup of eukaryotic metallothioneins which includes copper-induced metallothioneins from the protist Tetrahymena [].
Probab=46.89 E-value=12 Score=23.79 Aligned_cols=7 Identities=43% Similarity=1.578 Sum_probs=2.8
Q ss_pred CccCCCC
Q 039893 57 TCACVNC 63 (68)
Q Consensus 57 nC~C~pC 63 (68)
-|.|+||
T Consensus 41 ~CgC~~C 47 (74)
T PF12749_consen 41 PCGCSPC 47 (74)
T ss_pred CCCCcCC
Confidence 3334443
No 7
>PF05033 Pre-SET: Pre-SET motif; InterPro: IPR007728 This region is found in a number of histone lysine methyltransferases (HMTase), N-terminal to the SET domain; it is generally described as the pre-SET domain. Histone lysine methylation is part of the histone code that regulated chromatin function and epigenetic control of gene function. Histone lysine methyltransferases (HMTase) differ both in their substrate specificity for the various acceptor lysines as well as in their product specificity for the number of methyl groups (one, two, or three) they transfer. With just one exception [], the HMTases belong to SET family that can be classified according to the sequences surrounding the SET domain [, ]. Structural studies on the human SET7/9, a mono-methylase, have revealed the molecular basis for the specificity of the enzyme for the histone-target and the roles of the invariant residues in the SET domain in determining the methylation specificities []. The pre-SET domain, as found in the SUV39 SET family, contains nine invariant cysteine residues that are grouped into two segments separated by a region of variable length. These 9 cysteines coordinate 3 zinc ions to form a triangular cluster, where each of the zinc ions is coordinated by 4 four cysteines to give a tetrahedral configuration. The function of this domain is structural, holding together 2 long segments of random coils and stabilising the SET domain. The C-terminal region including the post-SET domain is disordered when not interacting with a histone tail and in the absence of zinc. The three conserved cysteines in the post-SET domain form a zinc-binding site [] when coupled to a fourth conserved cysteine in the knot-like structure close to the SET domain active site []. The structured post-SET region brings in the C-terminal residues that participate in S-adenosylmethine-binding and histone tail interactions. The three conserved cysteine residues are essential for HMTase activity, as replacement with serine abolishes HMTase activity []. ; GO: 0008270 zinc ion binding, 0018024 histone-lysine N-methyltransferase activity, 0034968 histone lysine methylation, 0005634 nucleus; PDB: 3K5K_A 2O8J_D 3RJW_B 1ML9_A 1PEG_B 1MVH_A 1MVX_A 3BO5_A 2RFI_B 3MO5_B ....
Probab=44.44 E-value=14 Score=22.53 Aligned_cols=9 Identities=11% Similarity=0.755 Sum_probs=5.8
Q ss_pred CCCCcccCC
Q 039893 11 ADRSQCVKK 19 (68)
Q Consensus 11 g~~c~Cgk~ 19 (68)
...|+|...
T Consensus 58 ~~~C~C~~~ 66 (103)
T PF05033_consen 58 PSNCECLQR 66 (103)
T ss_dssp TTTSHHHCC
T ss_pred CCCCcCccc
Confidence 556667766
No 8
>PF05522 Metallothio_6: Metallothionein; InterPro: IPR017980 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium, nickel, etc. They have a high content of cysteine residues that bind the metal ions through clusters of thiolate bonds [, ]. An empirical classification into three classes has been proposed by Fowler and coworkers [] and Kojima []. Members of class I are defined to include polypeptides related in the positions of their cysteines to equine MT-1B, and include mammalian MTs as well as from crustaceans and molluscs. Class II groups MTs from a variety of species, including sea urchins, fungi, insects and cyanobacteria. Class III MTs are atypical polypeptides composed of gamma-glutamylcysteinyl units []. This original classification system has been found to be limited, in the sense that it does not allow clear differentiation of patterns of structural similarities, either between or within classes. Consequently, all class I and class II MTs (the proteinaceous sequences) have now been grouped into families of phylogenetically-related and thus alignable sequences. This system subdivides the MT superfamily into families, subfamilies, subgroups, and isolated isoforms and alleles. The metallothionein superfamily comprises all polypeptides that resemble equine renal metallothionein in several respects []: e.g., low molecular weight; high metal content; amino acid composition with high Cys and low aromatic residue content; unique sequence with characteristic distribution of cysteines, and spectroscopic manifestations indicative of metal thiolate clusters. A MT family subsumes MTs that share particular sequence-specific features and are thought to be evolutionarily related. The inclusion of a MT within a family presupposes that its amino acid sequence is alignable with that of all members. Fifteen MT families have been characterised, each family being identified by its number and its taxonomic range: e.g., Family 1: vertebrate MTs [see http://www.bioc.unizh.ch/mtpage/protali.html]. Echinoidea (sea urchin, family 4) MTs are 64-67 residue proteins. Members of this family are recognised by the sequence pattern P-D-x-K-C-[V,F]-C-C-x(5)-C-x-C-x(4)-C-C-x(4)-C-C-x(4,6)-C-C located near the N terminus. The taxonomic range of the members extends to sea urchins (echinodea). The protein sequence is divided into two structural domains, each containing 9 and 11 Cys residues binding 3 and 4 bivalent metal ions, respectively. Family 4 includes subfamilies: e1, e2, they are separate phylogenetic groups. This entry includes the sea urchin proteins, and related sequences from worms.; PDB: 1QJK_A 1QJL_A.
Probab=41.05 E-value=13 Score=23.12 Aligned_cols=12 Identities=25% Similarity=0.864 Sum_probs=3.7
Q ss_pred CCCCCCCCcccC
Q 039893 7 NCDCADRSQCVK 18 (68)
Q Consensus 7 nC~Cg~~c~Cgk 18 (68)
+|.||+.++|+.
T Consensus 43 ~CKCga~CKC~~ 54 (65)
T PF05522_consen 43 ACKCGAGCKCGG 54 (65)
T ss_dssp T----TT--TTS
T ss_pred cccccCCceeCC
Confidence 567777777763
No 9
>PF03638 TCR: Tesmin/TSO1-like CXC domain, cysteine-rich domain; InterPro: IPR005172 This entry includes proteins that have two copies of a cysteine rich motif as follows: C-X-C-X4-C-X3-YC-X-C-X6-C-X3-C-X-C-X2-C. The family includes Tesmin Q9Y4I5 from SWISSPROT [] and TSO1 Q9LE32 from SWISSPROT []. This group of proteins is called a CXC domain in [].
Probab=16.82 E-value=85 Score=17.59 Aligned_cols=11 Identities=55% Similarity=1.561 Sum_probs=8.1
Q ss_pred CCCCCccCCCC
Q 039893 53 KCGPTCACVNC 63 (68)
Q Consensus 53 KCG~nC~C~pC 63 (68)
.|+++|.|..|
T Consensus 26 ~C~~~C~C~~C 36 (42)
T PF03638_consen 26 FCTPNCKCQNC 36 (42)
T ss_pred cCCCCcccCCC
Confidence 57777887766
No 10
>COG4104 Uncharacterized conserved protein [Function unknown]
Probab=16.70 E-value=1.8e+02 Score=19.16 Aligned_cols=41 Identities=29% Similarity=0.379 Sum_probs=24.0
Q ss_pred CCCCcccCCCCccccceEeeeccceEEEEEEEeecccCCCCCCCCC
Q 039893 11 ADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGP 56 (68)
Q Consensus 11 g~~c~Cgk~g~~y~~di~e~e~s~~~t~~v~gv~aaE~~ggCKCG~ 56 (68)
||.++|...+. -+.-|.|- + .+|+|-|.++|-+...+-||.
T Consensus 45 GD~~~Cp~~~~-~~~~I~~G--s--~tv~InGkpaA~~Gd~~~cG~ 85 (98)
T COG4104 45 GDPCSCPLSGH-QGCVIAEG--S--STVKINGKPAARHGDKTACGG 85 (98)
T ss_pred CCcccCCCCCC-CCCeEEec--c--ceEEECCEEeEEecceeccCc
Confidence 57888886631 11234444 2 334788888776655666664
Done!