BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 039930
(245 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From
Novosphingobium Aromaticivorans
Length = 415
Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust.
Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%)
Query: 97 EYIVSDKIFEALPLEEQKLWHSHAYEVKSGLWVNPRVPEMIGRPELDNMAKTYGKF-WCT 155
EY+ +K FE + + + W A E+K G V P D A YGK W T
Sbjct: 56 EYLAREKTFERICIRPAQFWEDKAVEMKLGAEVVSLDPAAHTVKLGDGSAIEYGKLIWAT 115
>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From
Pyrobaculum Aerophilum
pdb|1XQI|B Chain B, Crystal Structure Analysis Of An Ndp Kinase From
Pyrobaculum Aerophilum
pdb|1XQI|C Chain C, Crystal Structure Analysis Of An Ndp Kinase From
Pyrobaculum Aerophilum
Length = 195
Score = 28.9 bits (63), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 2/62 (3%)
Query: 165 PLGAPALMMSPQAVNLGMVRPDLVQKRDDKYNISTDALKQSRVEIDEPEWISPQADYWKQ 224
P+ L++ P AV G+V D + R K + ALK + +E E P ++ W Q
Sbjct: 14 PVEKTLLILKPDAVARGLV--DEIISRFKKAGLKIVALKXVKASPEEIERFYPSSEEWLQ 71
Query: 225 HA 226
A
Sbjct: 72 SA 73
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.132 0.412
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,167,540
Number of Sequences: 62578
Number of extensions: 342018
Number of successful extensions: 685
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 685
Number of HSP's gapped (non-prelim): 4
length of query: 245
length of database: 14,973,337
effective HSP length: 96
effective length of query: 149
effective length of database: 8,965,849
effective search space: 1335911501
effective search space used: 1335911501
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)