BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 039930
         (245 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From
           Novosphingobium Aromaticivorans
          Length = 415

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 1/60 (1%)

Query: 97  EYIVSDKIFEALPLEEQKLWHSHAYEVKSGLWVNPRVPEMIGRPELDNMAKTYGKF-WCT 155
           EY+  +K FE + +   + W   A E+K G  V    P        D  A  YGK  W T
Sbjct: 56  EYLAREKTFERICIRPAQFWEDKAVEMKLGAEVVSLDPAAHTVKLGDGSAIEYGKLIWAT 115


>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From
           Pyrobaculum Aerophilum
 pdb|1XQI|B Chain B, Crystal Structure Analysis Of An Ndp Kinase From
           Pyrobaculum Aerophilum
 pdb|1XQI|C Chain C, Crystal Structure Analysis Of An Ndp Kinase From
           Pyrobaculum Aerophilum
          Length = 195

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 165 PLGAPALMMSPQAVNLGMVRPDLVQKRDDKYNISTDALKQSRVEIDEPEWISPQADYWKQ 224
           P+    L++ P AV  G+V  D +  R  K  +   ALK  +   +E E   P ++ W Q
Sbjct: 14  PVEKTLLILKPDAVARGLV--DEIISRFKKAGLKIVALKXVKASPEEIERFYPSSEEWLQ 71

Query: 225 HA 226
            A
Sbjct: 72  SA 73


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,167,540
Number of Sequences: 62578
Number of extensions: 342018
Number of successful extensions: 685
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 685
Number of HSP's gapped (non-prelim): 4
length of query: 245
length of database: 14,973,337
effective HSP length: 96
effective length of query: 149
effective length of database: 8,965,849
effective search space: 1335911501
effective search space used: 1335911501
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)